CDK20 Protein, Mouse (sf9, GST)
CDK20 Protein, Mouse (sf9, GST) is the recombinant mouse-derived CDK20, expressed by Sf9 insect cells , with GST labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CDK20 Protein, Mouse (sf9, GST) is the recombinant mouse-derived CDK20, expressed by Sf9 insect cells , with GST labeled tag.
Background
CDK20 is a protein involved in cell growth, which activates CDK2 (a kinase critical for cell cycle control) by phosphorylating its 'Thr-160' residue (by similarity). It is essential for robust Sonic hedgehog (Shh) signaling responses during neural tube development. Additionally, CDK20 cooperates with TBC1D32 to regulate primary cilium structure by coordinating the assembly of the ciliary membrane and axoneme, enabling proper GLI2 activation in response to SHH signaling.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag GST
-
Accession
Q9JHU3-1 (M1-G346)
-
Gene ID105278
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CDK20; P42; Prev. CCRK; Cyclin-Dependent Protein Kinase H; Cell Division Protein Kinase 20; CDK-Activating Kinase P42; Cyclin-Dependent Kinase 20; CAK-Kinase P42; Cell Cycle-Related Kinase; CDCH; PNQALRE; Cell Cycle Related Kinase; Cyclin Dependent Kinase
-
AA Sequence
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGIPNQALREIKALQEIEDSQYVVQLKAVFPHGAGFVLAFEFMLSDLAEVVRHAQRPLAPAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGGRLYTHQVATRWYRAPELLYGARQYDQGVDLWAVGCIMGELLNGSPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKISFKEQAPVPLEEVLPDASPQALDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPSELPIPQRPGGPAPKAHPGPPHVHDFHVDRPLEESLLNPELIRPFIPEG
-
Molecular Weight
Approximately 64 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
