CDKN3 Protein, Human (sf9, GST)
CDKN3 Protein, Human (sf9, GST) is the recombinant human-derived CDKN3, expressed by Sf9 insect cells , with GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CDKN3 Protein, Human (sf9, GST) is the recombinant human-derived CDKN3, expressed by Sf9 insect cells , with GST labeled tag.
Background
CDKN3 is a protein that may play a role in cell cycle regulation. It is a dual-specificity CC phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. CDKN3 dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner. by similar: No related content.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
Q16667-1 (M1-R212)
-
Gene ID1033
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CDKN3; Cyclin-Dependent Kinase Inhibitor; Cyclin Dependent Kinase Inhibitor 3; CIP2; CDI1; Cyclin-Dependent Kinase Inhibitor 3 Splice Variant; KAP; Cyclin-Dependent Kinase Interacting Protein 2; Cyclin-Dependent Kinase Inhibitor 3; Cyclin-Dependent Kinase
-
AA Sequence
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
-
Molecular Weight
Approximately 51 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
