1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. CEA Cell Adhesion Molecule 7 (CEACAM7)
  6. CEACAM7 Protein, Human (HEK293, His)

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC). CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC). CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CEAM7/CEACAM7 are cell surface glycoproteins belonging to the carcinoembryonic antigen (CEA) protein family. Carcinoembryonic antigen (CEA) is a classic colorectal cancer tumor marker, such as CEACAM1, CEACAM5, and CEACAM6, which are considered effective clinical biomarkers and therapeutic targets for melanoma, lung, colorectal, and pancreatic cancer. CEACAM5, CEACAM6, CEACAM7, and CEACAM8 are associated with the cell membrane through GPI connections. Among them, CEACAM6 and CEACAM7 are differentially expressed in normal tissues and dysregulated in hyperplastic colorectal polyps and early adenomas. The expression of CEACAM7 may be downregulated in colon and rectal cancers or may predict rectal cancer recurrence. There is an association between higher expression of CEACAM7 and poor prognosis in patients with a high risk ratio and may serve as a potential early diagnostic and/or prognostic marker for pancreatic ductal adenocarcinoma (PDAC).

Actividad biológica

Immobilized Human CEACAM3 (HY-P72694) at 2 μg/mL (100 μL/well) can bind Biotinylated Human CEACAM7 Protein (HY-P7825), The ED50 for this effect is 1.910 μg/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAI21133.1 (T36-F142)

Gene ID
Molecular Construction
N-term
CEACAM7 (T36-F142)
Accession # AAI21133.1
6*His
C-term
Protein Length

Partial

Synonyms
rHuCarcinoembryonic antigen-related cell adhesion molecule 7/CEACAM7, His; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7; Carcinoembryonic Antigen CGM2; CEACAM7; CGM2
AA Sequence

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVF

Peso molecular

20-30 kDa

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

CEACAM7 Protein, Human (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
CEACAM7 Protein, Human (HEK293, His)
Cat. No.:
HY-P7825
Cantidad:
MCE Japan Authorized Agent: