Copy Link Print Information

CEACAM7 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC). CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CEACAM7 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CEAM7/CEACAM7 belongs to the class of carcinoembryonic antigen (CEA) proteins, a cell surface glycoprotein. CEACAM7 is dysregulated in hyperplastic colorectal polyps and early adenomas and may serve as a potential early diagnostic and/or prognostic marker for pancreatic cancer (PanCa) or pancreatic ductal adenocarcinoma (PDAC). CEACAM7 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CEAM7/CEACAM7 are cell surface glycoproteins belonging to the carcinoembryonic antigen (CEA) protein family. Carcinoembryonic antigen (CEA) is a classic colorectal cancer tumor marker, such as CEACAM1, CEACAM5, and CEACAM6, which are considered effective clinical biomarkers and therapeutic targets for melanoma, lung, colorectal, and pancreatic cancer. CEACAM5, CEACAM6, CEACAM7, and CEACAM8 are associated with the cell membrane through GPI connections. Among them, CEACAM6 and CEACAM7 are differentially expressed in normal tissues and dysregulated in hyperplastic colorectal polyps and early adenomas. The expression of CEACAM7 may be downregulated in colon and rectal cancers or may predict rectal cancer recurrence. There is an association between higher expression of CEACAM7 and poor prognosis in patients with a high risk ratio and may serve as a potential early diagnostic and/or prognostic marker for pancreatic ductal adenocarcinoma (PDAC).

Verified Bioactivity

Immobilized Human CEACAM3 (HY-P72694) at 2 μg/mL (100 μL/well) can bind Biotinylated Human CEACAM7 Protein (HY-P7825), The ED50 for this effect is 1.910 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    AAI21133.1 (T36-F142)

  • Gene ID
    1087  [NCBI]
  • Molecular Construction
    • N-term
    • CEACAM7 (T36-F142)
      Accession # AAI21133.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Ig-like V-type Domain

  • Synonyms

    CEACAM7; Carcinoembryonic Antigen Gene Family Member 2; Prev. CGM2; Carcinoembryonic Antigen CGM2; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7; CEA; Carcinoembryonic Antigen Related Cell Adhesion Molecule 7; CEA Cell Adhesion Molecule 7; Cel

  • AA Sequence

    TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVF

  • Predicted Molecular Mass

    13.1 kDa

  • Molecular Weight

    Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CEACAM7 Protein, Human (HEK293, His) Product Image
    1/16
  • CEACAM7 Protein, Human (HEK293, His) Product Image