Copy Link Print Information

CEACAM8/CD66b Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (HEK293, His) is the recombinant human-derived CEACAM8/CD66b protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CEACAM8/CD66b Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (HEK293, His) is the recombinant human-derived CEACAM8/CD66b protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CEACAM8/CD66b protein, a cell surface glycoprotein, actively contributes to cell adhesion in a calcium-independent manner. It primarily mediates heterophilic cell adhesion, forming interactions with other carcinoembryonic antigen-related cell adhesion molecules, including CEACAM6. Notably, the heterophilic interaction with CEACAM8 takes place specifically in activated neutrophils. CEACAM8 operates as a monomer and also forms heterodimers with CEACAM6, engaging in heterodimerization through its Ig-like V-type domain. This emphasizes its role as a versatile cell adhesion molecule, participating in interactions with various partners and highlighting its significance in diverse cellular contexts, particularly in activated neutrophils and during heterophilic adhesion with other CEACAM family members.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P31997 (Q35-H141)

  • Gene ID
    1088  [NCBI]
  • Molecular Construction
    • N-term
    • CEACAM8 (Q35-H141)
      Accession # P31997
    • 6*His
    • C-term
  • Protein Length

    Full Length of Ig-like V-type Domain

  • Synonyms

    CEACAM8; Carcinoembryonic Antigen CGM6; Prev. CGM6; CDNA, FLJ93041, Homo Sapiens Carcinoembryonic Antigen-Related Cell Adhesionmolecule 8 (CEACAM8), MRNA; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8; Carcinoembryonic Antigen Gene Family Memb

  • AA Sequence

    QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVH

  • Predicted Molecular Mass

    13 kDa

  • Molecular Weight

    Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CEACAM8/CD66b Protein, Human (HEK293, His) Product Image
    1/16
  • CEACAM8/CD66b Protein, Human (HEK293, His) Product Image