CEACAM8/CD66b Protein, Human (HEK293, His)

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (HEK293, His) is the recombinant human-derived CEACAM8/CD66b protein, expressed by HEK293 , with C-6*His labeled tag.

CEACAM8/CD66b protein, a cell surface glycoprotein, actively contributes to cell adhesion in a calcium-independent manner. It primarily mediates heterophilic cell adhesion, forming interactions with other carcinoembryonic antigen-related cell adhesion molecules, including CEACAM6. Notably, the heterophilic interaction with CEACAM8 takes place specifically in activated neutrophils. CEACAM8 operates as a monomer and also forms heterodimers with CEACAM6, engaging in heterodimerization through its Ig-like V-type domain. This emphasizes its role as a versatile cell adhesion molecule, participating in interactions with various partners and highlighting its significance in diverse cellular contexts, particularly in activated neutrophils and during heterophilic adhesion with other CEACAM family members.

Human

HEK293

C-6*His

P31997 (Q35-H141)

1088  [NCBI]

Partial

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVH

Approximately 17-25 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.