CEBP gamma/CEBPG Protein, Human (His)
Based on 1 Customer Validation
CEBP gamma/CEBPG protein is a transcription factor that regulates genes by binding to their promoter and enhancer regions. It targets IL-4 and immunoglobulin heavy chains, binding to enhancer elements PRE-I and GPE1 in the G-CSF gene promoter. CEBP gamma/CEBPG Protein, Human (His) is the recombinant human-derived CEBP gamma/CEBPG protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CEBP gamma/CEBPG protein is a transcription factor that regulates genes by binding to their promoter and enhancer regions. It targets IL-4 and immunoglobulin heavy chains, binding to enhancer elements PRE-I and GPE1 in the G-CSF gene promoter. CEBP gamma/CEBPG Protein, Human (His) is the recombinant human-derived CEBP gamma/CEBPG protein, expressed by E. coli , with N-His labeled tag.
Background
CEBP gamma/CEBPG protein functions as a transcription factor, exerting its regulatory influence by binding to both the promoter and enhancer regions of target genes. It specifically binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene, as well as to the promoter and enhancer regions of the immunoglobulin heavy chain. Additionally, CEBP gamma/CEBPG binds to GPE1, a cis-acting element in the G-CSF gene promoter. Its DNA binding occurs as a dimer, and it has the capacity to form stable heterodimers with CEBPA and CEBPB, underscoring its versatile interaction profile. Furthermore, CEBP gamma/CEBPG interacts with ZNF638, and this interaction contributes to increased transcriptional activation, further highlighting its role in modulating gene expression.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P53567 (P39-N147)
-
Molecular Construction
-
N-term
-
His
-
CEBPG (P39-N147)
Accession # P53567 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CEBPG; CCAAT/Enhancer Binding Protein (C/EBP), Gamma; CCAAT Enhancer Binding Protein Gamma; CCAAT/Enhancer-Binding Protein Gamma; IG/EBP-1; C/EBP Gamma; GPE1BP; CCAAT/Enhancer Binding Protein Gamma
-
AA Sequence
PGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDN
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
