1. Recombinant Proteins
  2. Others
  3. CEBP gamma/CEBPG Protein, Human (His)

CEBP gamma/CEBPG protein is a transcription factor that regulates genes by binding to their promoter and enhancer regions. It targets IL-4 and immunoglobulin heavy chains, binding to enhancer elements PRE-I and GPE1 in the G-CSF gene promoter. CEBP gamma/CEBPG Protein, Human (His) is the recombinant human-derived CEBP gamma/CEBPG protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEBP gamma/CEBPG protein is a transcription factor that regulates genes by binding to their promoter and enhancer regions. It targets IL-4 and immunoglobulin heavy chains, binding to enhancer elements PRE-I and GPE1 in the G-CSF gene promoter. CEBP gamma/CEBPG Protein, Human (His) is the recombinant human-derived CEBP gamma/CEBPG protein, expressed by E. coli , with N-His labeled tag.

Background

CEBP gamma/CEBPG protein functions as a transcription factor, exerting its regulatory influence by binding to both the promoter and enhancer regions of target genes. It specifically binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene, as well as to the promoter and enhancer regions of the immunoglobulin heavy chain. Additionally, CEBP gamma/CEBPG binds to GPE1, a cis-acting element in the G-CSF gene promoter. Its DNA binding occurs as a dimer, and it has the capacity to form stable heterodimers with CEBPA and CEBPB, underscoring its versatile interaction profile. Furthermore, CEBP gamma/CEBPG interacts with ZNF638, and this interaction contributes to increased transcriptional activation, further highlighting its role in modulating gene expression.

Species

Human

Source

E. coli

Tag

N-His

Accession

P53567 (P39-N147)

Gene ID
Molecular Construction
N-term
His
CEBPG (P39-N147)
Accession # P53567
C-term
Protein Length

Partial

Synonyms
CCAAT/enhancer-binding protein gamma; C/EBP gamma; CEBPG
AA Sequence

PGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDN

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CEBP gamma/CEBPG Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CEBP gamma/CEBPG Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEBP gamma/CEBPG Protein, Human (His)
Cat. No.:
HY-P74254
Quantity:
MCE Japan Authorized Agent: