Cellular tumor antigen P53/TP53 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The cellular tumor antigen P53/TP53 is a tumor suppressor that can induce growth arrest or apoptosis in a variety of tumor types. It regulates the cell cycle by negatively controlling genes critical for division. Cellular tumor antigen P53/TP53, Human (His) is the recombinant human-derived Cellular tumor antigen P53/TP53 protein, expressed by E. coli, with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The cellular tumor antigen P53/TP53 is a tumor suppressor that can induce growth arrest or apoptosis in a variety of tumor types. It regulates the cell cycle by negatively controlling genes critical for division. Cellular tumor antigen P53/TP53, Human (His) is the recombinant human-derived Cellular tumor antigen P53/TP53 protein, expressed by E. coli, with N-6*His labeled tag.

Background

Cellular tumor antigen P53/TP53 functions as a tumor suppressor across various tumor types, exhibiting the ability to induce growth arrest or apoptosis depending on the physiological context and cell type. Involved in cell cycle regulation, TP53 acts as a trans-activator that negatively regulates cell division by controlling a set of genes essential for this process. Its pro-apoptotic activity is mediated through the stimulation of BAX and FAS antigen expression or repression of Bcl-2 expression. TP53 induces apoptosis by interacting with PPP1R13B/ASPP1 or TP53BP2/ASPP2, and this activity is inhibited by PPP1R13L/iASPP. In cooperation with mitochondrial PPIF, TP53 participates in activating oxidative stress-induced necrosis, independent of transcription. It induces the transcription of long intergenic non-coding RNAs, such as lincRNA-p21 and lincRNA-Mkln1, which contribute to TP53-dependent transcriptional repression and apoptosis. Additionally, TP53 is implicated in Notch signaling cross-over, prevents CDK7 kinase activity in response to DNA damage, and regulates the circadian clock by repressing CLOCK-BMAL1-mediated transcriptional activation of PER2. Different isoforms of TP53 exhibit variations in transactivation activity, apoptosis induction, and growth suppression, showcasing the complexity of its regulatory functions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    TP53; Mutant Tumor Protein 53; Tumor Protein P53; Li-Fraumeni Syndrome; P53; Tumor Supressor P53; Cellular Tumor Antigen P53; Tumor Protein 53; LFS1; P53-Ex10 Isoform; Tumor Suppressor P53; Truncated TP53; Phosphoprotein P53; Truncated P53; Antigen NY-CO-

  • AA Sequence

    SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNT

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 25 mM HEPES, pH 7.5, 150 mM NaCl, 2 mM GSH.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00