CGB7 Protein, Human (sf9, His)
The CGB7 protein is the beta subunit of human chorionic gonadotropin (hCG) and is critical during pregnancy, stimulating steroid synthesis that is essential for maintaining pregnancy. As a unique β subunit, CGB7 confers hCG specificity and plays a unique role in reproductive physiology. CGB7 Protein, Human (sf9, His) is the recombinant human-derived CGB7 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CGB7 protein is the beta subunit of human chorionic gonadotropin (hCG) and is critical during pregnancy, stimulating steroid synthesis that is essential for maintaining pregnancy. As a unique β subunit, CGB7 confers hCG specificity and plays a unique role in reproductive physiology. CGB7 Protein, Human (sf9, His) is the recombinant human-derived CGB7 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The CGB7 Protein serves as the beta subunit of human chorionic gonadotropin (hCG), a complex glycoprotein composed of two glycosylated subunits, alpha and beta, which are non-covalently associated. The alpha subunit is identical to those found in pituitary gonadotropin hormones (LH, FSH, and TSH). Notably, the beta subunits are distinct in each of the hormones, conferring receptor and biological specificity. CGB7 plays an essential role in pregnancy and maternal adaptation, stimulating the ovaries to synthesize steroids crucial for maintaining pregnancy. It functions as a heterodimer, consisting of a common alpha chain identical in LH, FSH, TSH, and HCG, and a unique beta chain that imparts specificity to each hormone. Understanding the role of CGB7 contributes to our knowledge of reproductive physiology, with potential implications for fertility treatments and maternal health. Further exploration of CGB7's functions holds promise for enhancing our understanding of its contributions to the intricate processes of pregnancy and reproductive adaptation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P0DN87-1 (S21-Q165)
-
Molecular Construction
-
N-term
-
CGB7 (S21-Q165)
Accession # P0DN87-1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CGB7; Choriogonadotropin Subunit Beta 7; Chorionic Gonadotropin Subunit Beta 7; Chorionic Gonadotropin Beta 7 Subunit; CG-Beta-A; Chorionic Gonadotropin Beta Subunit 5; Chorionic Gonadotropin, Beta Polypeptide 7; CGB6; Chorionic Gonadotropin Beta Subunit
-
AA Sequence
SREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
-
Predicted Molecular Mass
17 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
