CGB7 Protein, Human (sf9, His)

The CGB7 protein is the beta subunit of human chorionic gonadotropin (hCG) and is critical during pregnancy, stimulating steroid synthesis that is essential for maintaining pregnancy. As a unique β subunit, CGB7 confers hCG specificity and plays a unique role in reproductive physiology. CGB7 Protein, Human (sf9, His) is the recombinant human-derived CGB7 protein, expressed by Sf9 insect cells , with C-His labeled tag.

The CGB7 Protein serves as the beta subunit of human chorionic gonadotropin (hCG), a complex glycoprotein composed of two glycosylated subunits, alpha and beta, which are non-covalently associated. The alpha subunit is identical to those found in pituitary gonadotropin hormones (LH, FSH, and TSH). Notably, the beta subunits are distinct in each of the hormones, conferring receptor and biological specificity. CGB7 plays an essential role in pregnancy and maternal adaptation, stimulating the ovaries to synthesize steroids crucial for maintaining pregnancy. It functions as a heterodimer, consisting of a common alpha chain identical in LH, FSH, TSH, and HCG, and a unique beta chain that imparts specificity to each hormone. Understanding the role of CGB7 contributes to our knowledge of reproductive physiology, with potential implications for fertility treatments and maternal health. Further exploration of CGB7's functions holds promise for enhancing our understanding of its contributions to the intricate processes of pregnancy and reproductive adaptation.

Human

Sf9 insect cells

C-His

P0DN87-1 (S21-Q165)

94027  [NCBI]

Full Length of Isoform-1 Mature Protein

SREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ

Approximately 25 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.