CHEK2 Protein, Mouse (sf9, His-GST)

CHEK2 is a serine/threonine protein kinase that coordinates cellular responses to DNA double-strand breaks by activating cell cycle arrest, DNA repair, and apoptosis. It phosphorylates effectors and inhibits CDC25A, CDC25B, and CDC25C, thereby enhancing CDK cyclin inhibition and cell cycle arrest. CHEK2 Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived CHEK2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CHEK2 is a serine/threonine protein kinase that coordinates cellular responses to DNA double-strand breaks by activating cell cycle arrest, DNA repair, and apoptosis. It phosphorylates effectors and inhibits CDC25A, CDC25B, and CDC25C, thereby enhancing CDK cyclin inhibition and cell cycle arrest. CHEK2 Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived CHEK2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

CHEK2, a serine/threonine-protein kinase, stands as a crucial orchestrator of cellular responses to DNA double-strand breaks, contributing to checkpoint-mediated cell cycle arrest, DNA repair activation, and apoptosis. Upon activation, CHEK2 phosphorylates a myriad of effectors, particularly at the consensus sequence [L-X-R-X-X-S/T]. Its regulatory role extends to cell cycle checkpoint arrest, achieved through the inhibition of CDC25A, CDC25B, and CDC25C, leading to enhanced inhibitory tyrosine phosphorylation of CDK-cyclin complexes and impeding cell cycle progression. Furthermore, CHEK2 impacts DNA repair processes by phosphorylating BRCA2, facilitating the association of RAD51 with chromatin and promoting homologous recombination. Its influence on apoptosis is evident through the phosphorylation of key proteins, including p53/TP53, MDM4, and PML. CHEK2's tumor suppressor function is highlighted by its involvement in transcriptional regulation of pro-apoptotic genes and its potential role in mitotic spindle assembly by phosphorylating BRCA1. Notably, CHEK2's absence may contribute to chromosomal instability observed in certain cancer cells, emphasizing its multifaceted role in maintaining genomic integrity.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • CHEK2 (M1-L546)
      Accession # Q9Z265
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CHEK2; BA444G7; Prev. RAD53; Non-Specific Serine/Threonine Protein Kinase; CDS1; CHK2 (Checkpoint, S.Pombe) Homolog; CHK2; CHK2 Checkpoint Homolog (S. Pombe); Serine/Threonine-Protein Kinase Chk2; Truncated Checkpoint Kinase 2; HuCds1; Checkpoint-Like Pro

  • AA Sequence

    MKSHHQSHSSTSSKAHDSASCSQSQGGFSQPQGTPSQLHELSQYQGSSSSSTGTVPSSSQSSHSSSGTLSSLETVSTQELCSIPEDQEPEEPGPAPWARLWALQDGFSNLDCVNDNYWFGRDKSCEYCFDGPLLRRTDKYRTYSKKHFRIFREMGPKNCYIVYIEDHSGNGTFVNTELIGKGKRCPLSNNSEIALSLCRNKVFVFFDLTVDDQSVYPKELRDEYIMSKTLGSGACGEVKMAFERKTCQKVAIKIISKRRFALGSSREADTAPSVETEIEILKKLNHPCIIKIKDVFDAEDYYIVLELMEGGELFDRVVGNKRLKEATCKLYFYQMLVAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGQSKILGETSLMRTLCGTPTYLAPEVLVSNGTAGYSRAVDCWSLGVILFICLSGYPPFSEHKTQVSLKDQITSGKYNFIPEVWTDVSEEALDLVKKLLVVDPKARLTTEEALNHPWLQDEYMKKKFQDLLVQEKNSVTLPVAPAQTSSQKRPLELEVEGMPSTKRLSVCGAVL

  • Predicted Molecular Mass

    89 kDa

  • Molecular Weight

    Approximately 90 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00