CHMP1B Protein, Human (GST)

CHMP1B Protein, Human (GST) is the recombinant human-derived CHMP1B protein, expressed by E. coli, with N-GST tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CHMP1B Protein, Human (GST) is the recombinant human-derived CHMP1B protein, expressed by E. coli, with N-GST tag.

Background

CHMP1B is a probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III), which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) generated by invagination and scission from the endosomal limiting membrane, primarily delivered to lysosomes for degradation of membrane proteins (e.g., stimulated growth factor receptors, lysosomal enzymes, and lipids). The MVB pathway requires sequential functions of ESCRT-O, -I, -II, and -III complexes. ESCRT-III proteins typically dissociate from the invaginating membrane before ILV release. The ESCRT machinery also operates in topologically equivalent membrane fission events, such as cytokinesis and enveloped virus budding (e.g., HIV-1 and other lentiviruses). ESCRT-III proteins mediate vesicle extrusion and/or membrane fission, potentially in conjunction with the AAA ATPase VPS4. It participates in cytokinesis by recruiting VPS4A/VPS4B and SPAST to the midbody and facilitates HIV-1 p6- and p9-dependent virus release.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • CHMP1B (M1-V199)
      Accession # Q7LBR1
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CHMP1B; Vps46-2; Charged Multivesicular Body Protein 1B; Charged Multivesicular Body Protein 1b; CHMP1.5; VPS46 Homolog B (S. Cerevisiae); C18orf2; Vacuolar Protein Sorting 46-2; Vps46B; VPS46 Homolog B; Vacuolar Protein Sorting-Associated Protein 46-2; C

  • AA Sequence

    MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

  • Predicted Molecular Mass

    49.1 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00