1. Recombinant Proteins
  2. Others
  3. CHMP1B Protein, Human (GST)

CHMP1B Protein, Human (GST) is the recombinant human-derived CHMP1B protein, expressed by E. coli, with N-GST tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

CHMP1B Protein, Human (GST) is the recombinant human-derived CHMP1B protein, expressed by E. coli, with N-GST tag.

Background

CHMP1B is a probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III), which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) generated by invagination and scission from the endosomal limiting membrane, primarily delivered to lysosomes for degradation of membrane proteins (e.g., stimulated growth factor receptors, lysosomal enzymes, and lipids). The MVB pathway requires sequential functions of ESCRT-O, -I, -II, and -III complexes. ESCRT-III proteins typically dissociate from the invaginating membrane before ILV release. The ESCRT machinery also operates in topologically equivalent membrane fission events, such as cytokinesis and enveloped virus budding (e.g., HIV-1 and other lentiviruses). ESCRT-III proteins mediate vesicle extrusion and/or membrane fission, potentially in conjunction with the AAA ATPase VPS4. It participates in cytokinesis by recruiting VPS4A/VPS4B and SPAST to the midbody and facilitates HIV-1 p6- and p9-dependent virus release.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q7LBR1 (M1-V199)

Gene ID

57132

Molecular Construction
N-term
GST
CHMP1B (M1-V199)
Accession # Q7LBR1
C-term
Protein Length

Full Length

Synonyms
CHMP1B; C18orf2Charged multivesicular body protein 1b; CHMP1.5; Chromatin-modifying protein 1b; CHMP1b; Vacuolar protein sorting-associated protein 46-2; Vps46-2; hVps46-2
AA Sequence

MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Predicted Molecular Mass
49.1kDa
Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación

CHMP1B Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

CHMP1B Protein, Human (GST)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
CHMP1B Protein, Human (GST)
Cat. No.:
HY-P704074
Cantidad:
MCE Japan Authorized Agent: