CIRBP Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CIRBP is a cold-induced mRNA-binding protein that plays a key role in cellular responses to genotoxic stress, exerting a protective effect by stabilizing transcripts of genes critical for cell survival. As a translation activator, CIRBP appears to be critical for cold-induced inhibition of cell proliferation. CIRBP Protein, Human (His) is the recombinant human-derived CIRBP protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CIRBP is a cold-induced mRNA-binding protein that plays a key role in cellular responses to genotoxic stress, exerting a protective effect by stabilizing transcripts of genes critical for cell survival. As a translation activator, CIRBP appears to be critical for cold-induced inhibition of cell proliferation. CIRBP Protein, Human (His) is the recombinant human-derived CIRBP protein, expressed by E. coli , with N-His labeled tag.

Background

Cold-Inducible RNA Binding Protein (CIRBP) is a crucial player in the cellular response to genotoxic stress, exerting a protective role by stabilizing transcripts of genes associated with cell survival. As a translational activator, CIRBP is involved in the cold-induced suppression of cell proliferation and binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts like RPA2 and TXN. It acts as a translational repressor, promoting the assembly of stress granules (SGs) when overexpressed. Additionally, CIRBP interacts with EIF4G1 and associates with ribosomes, emphasizing its multifaceted involvement in cellular stress responses and RNA processing (

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CIRBP (M1-E172)
      Accession # Q14011-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CIRBP; Glycine-Rich RNA Binding Protein; Cold Inducible RNA Binding Protein; A18 HnRNP; Cold-Inducible RNA-Binding Protein; Cold Inducible RNA-Binding Protein; CIRP; Testicular Tissue Protein Li 39; Glycine-Rich RNA-Binding Protein CIRP; A18HNRNP

  • AA Sequence

    MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00