CIRBP Protein, Human (His)
Based on 1 publication(s) in Google Scholar
CIRBP is a cold-induced mRNA-binding protein that plays a key role in cellular responses to genotoxic stress, exerting a protective effect by stabilizing transcripts of genes critical for cell survival. As a translation activator, CIRBP appears to be critical for cold-induced inhibition of cell proliferation. CIRBP Protein, Human (His) is the recombinant human-derived CIRBP protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CIRBP is a cold-induced mRNA-binding protein that plays a key role in cellular responses to genotoxic stress, exerting a protective effect by stabilizing transcripts of genes critical for cell survival. As a translation activator, CIRBP appears to be critical for cold-induced inhibition of cell proliferation. CIRBP Protein, Human (His) is the recombinant human-derived CIRBP protein, expressed by E. coli , with N-His labeled tag.
Background
Cold-Inducible RNA Binding Protein (CIRBP) is a crucial player in the cellular response to genotoxic stress, exerting a protective role by stabilizing transcripts of genes associated with cell survival. As a translational activator, CIRBP is involved in the cold-induced suppression of cell proliferation and binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts like RPA2 and TXN. It acts as a translational repressor, promoting the assembly of stress granules (SGs) when overexpressed. Additionally, CIRBP interacts with EIF4G1 and associates with ribosomes, emphasizing its multifaceted involvement in cellular stress responses and RNA processing (
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Int J Biol Macromol
Extracellular cold-inducible RNA-binding protein drives NLRP3-mediated pyroptosis in acute ischemic stroke. [Abstract]2026 Apr:358:151356. PMID: 41933753
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q14011-1 (M1-E172)
-
Molecular Construction
-
N-term
-
6*His
-
CIRBP (M1-E172)
Accession # Q14011-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CIRBP; Glycine-Rich RNA Binding Protein; Cold Inducible RNA Binding Protein; A18 HnRNP; Cold-Inducible RNA-Binding Protein; Cold Inducible RNA-Binding Protein; CIRP; Testicular Tissue Protein Li 39; Glycine-Rich RNA-Binding Protein CIRP; A18HNRNP
-
AA Sequence
MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)