Copy Link Print Information

CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc)
  • CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The C-type lectin-like domain-containing protein 1 (CLEC1A) is a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily, known for its diverse functions, including cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. This protein is implicated in the potential regulation of dendritic cell function. Situated on chromosome 12p13 in the natural killer gene complex region, CLEC1A is closely linked to other members of the CTL/CTLD superfamily. Alternative splicing gives rise to multiple transcript variants, contributing to the functional diversity of this gene. With biased expression observed in placenta (RPKM 18.1), lung (RPKM 3.8), and 10 other tissues, CLEC1A underscores its potential role in various physiological contexts.

Verified Bioactivity

Measured by its ability to bind fluorescein-conjugated E.coli Bioparticles. The ED50 for this effect is 2.703 μg/mL, corresponding to a specific activity is 3.70×102 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession

    Q8BWY2 (Q73-Q269)

  • Gene ID
    243653  [NCBI]
  • Molecular Construction
    • N-term
    • hFc
    • CLEC-1 (Q73-Q269)
      Accession # Q8BWY2
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC1A; CDNA FLJ34670 Fis, Clone LIVER2001076, Highly Similar To C-Type Lectin Domain Family 1 Member A; C-Type Lectin Domain Family 1 Member A; C-Type Lectin Domain Family 1, Member A, Isoform CRA_c; CLEC-1; C-Type Lectin Domain Family 1, Member A; CLEC1

  • AA Sequence

    QFYQLSNIQQDSITEKDEKLGNMSRQLQSLQAQNRKLIETLQQVAVKLCRELYNKSGGHRCSPCPEKWKWYGDKCYQFYKESKNWQSCEYFCLADNATMLKISTQEELDFAMPQSYSEFFYSYWTGLSRNGSGKAWLWTDGTPYSFELFEIIIDPTNLRNRDCMTIFNGKAYSKDCKELRRCACERIAGRVVPGELQ

  • Molecular Weight

    Approximately 58-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc) Product Image
    1/16
  • Experimental Validation Results for CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc)
  • CLEC-1/CLEC1A Protein, Mouse (HEK293, hFc) Product Image