Copy Link Print Information

CLEC10A/CD301 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CLEC10A/CD301 Protein, implicated in probable immune response regulation, binds Tn-Ag sugar moieties in a calcium-dependent manner. Recognizing these structures on carcinoma cells, CLEC10A/CD301 suggests a role in immune surveillance. Further exploration of its molecular interactions and downstream signaling pathways will enhance understanding of its contributions to immune modulation, especially in the context of cancer immunity. CLEC10A/CD301 Protein, Human (HEK293, His) is the recombinant human-derived CLEC10A/CD301 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CLEC10A/CD301 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CLEC10A/CD301 Protein, implicated in probable immune response regulation, binds Tn-Ag sugar moieties in a calcium-dependent manner. Recognizing these structures on carcinoma cells, CLEC10A/CD301 suggests a role in immune surveillance. Further exploration of its molecular interactions and downstream signaling pathways will enhance understanding of its contributions to immune modulation, especially in the context of cancer immunity. CLEC10A/CD301 Protein, Human (HEK293, His) is the recombinant human-derived CLEC10A/CD301 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CLEC10A/CD301 protein is implicated in the probable regulation of adaptive and innate immune responses. Functioning in a calcium-dependent manner, it binds to terminal galactose and N-acetylgalactosamine units, specifically those linked to serine or threonine. These sugar moieties, known as Tn-Ag, are expressed in various carcinoma cells. The involvement of CLEC10A/CD301 in recognizing and binding to these specific carbohydrate structures suggests a potential role in immune surveillance, particularly in the context of carcinoma cells. Further exploration of the molecular interactions and downstream signaling pathways influenced by CLEC10A/CD301 will enhance our understanding of its contributions to immune modulation and its potential implications in cancer immunity.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q8IUN9 (Q61-H316)

  • Gene ID
    10462  [NCBI]
  • Molecular Construction
    • N-term
    • CLEC10A (Q61-H316)
      Accession # Q8IUN9
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC10A; DC-Asialoglycoprotein Receptor; Prev. CLECSF13; MGL; Prev. CLECSF14; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 13 (Macrophage-Derived); HML; CDNA FLJ78539, Highly Similar To Homo Sapiens C-Type Lectin

  • AA Sequence

    QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

  • Predicted Molecular Mass

    29.8 kDa

  • Molecular Weight

    Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CLEC10A/CD301 Protein, Human (HEK293, His) Product Image
    1/16
  • CLEC10A/CD301 Protein, Human (HEK293, His) Product Image