CLEC4D Protein, Human (HEK293, His)

The CLEC4D protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system, recognizing DAMPs and PAMPs on bacteria and fungi. It forms a functional complex with FCER1G in myeloid cells, triggering immune activation. CLEC4D Protein, Human (HEK293, His) is the recombinant human-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CLEC4D protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system, recognizing DAMPs and PAMPs on bacteria and fungi. It forms a functional complex with FCER1G in myeloid cells, triggering immune activation. CLEC4D Protein, Human (HEK293, His) is the recombinant human-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

Background

CLEC4D, a calcium-dependent lectin, operates as a pattern recognition receptor (PRR) in the innate immune system, discerning both damage-associated molecular patterns (DAMPs) and pathogen-associated molecular patterns (PAMPs) from bacteria and fungi. Recognizing alpha-mannans on C. albicans hyphae and mycobacterial trehalose 6,6'-dimycolate (TDM), CLEC4D forms a functional complex with the signaling adapter Fc receptor gamma chain/FCER1G, likely through its interaction with CLEC4E, in myeloid cells. Binding of TDM or C. albicans alpha-mannans to this receptor complex induces the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, activating SYK, CARD9, and NF-kappa-B. This activation drives the maturation of antigen-presenting cells and influences antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. CLEC4D, when forming a heterodimer with CLEC6A, exhibits activity against fungal infections. Additionally, it functions as an endocytic receptor, suggesting a role in antigen uptake at the site of infection, either for antigen clearance or for processing and subsequent presentation to T-cells. The heterodimerization with CLEC4E and CLEC6A further highlights the dynamic and versatile nature of CLEC4D in immune surveillance and response mechanisms.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CLEC4D (G52-N215)
      Accession # Q8WXI8
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CLEC4D; C-Type Lectin-Like Receptor 6; Prev. CLECSF8; Dectin 3; Dectin-3; CLEC-6; MCL; C-Type Lectin Domain Family 4, Member D; CD368; Macrophage C-Type Lectin; Mpcl; C-Type Lectin Receptor; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lect

  • AA Sequence

    GTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

  • Predicted Molecular Mass

    21.2 kDa

  • Molecular Weight

    Approximately 21-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00