1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CLEC-6
  6. CLEC4D Protein, Human (HEK293, His)

The CLEC4D protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system, recognizing DAMPs and PAMPs on bacteria and fungi. It forms a functional complex with FCER1G in myeloid cells, triggering immune activation. CLEC4D Protein, Human (HEK293, His) is the recombinant human-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
5 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CLEC4D protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system, recognizing DAMPs and PAMPs on bacteria and fungi. It forms a functional complex with FCER1G in myeloid cells, triggering immune activation. CLEC4D Protein, Human (HEK293, His) is the recombinant human-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

Background

CLEC4D, a calcium-dependent lectin, operates as a pattern recognition receptor (PRR) in the innate immune system, discerning both damage-associated molecular patterns (DAMPs) and pathogen-associated molecular patterns (PAMPs) from bacteria and fungi. Recognizing alpha-mannans on C. albicans hyphae and mycobacterial trehalose 6,6'-dimycolate (TDM), CLEC4D forms a functional complex with the signaling adapter Fc receptor gamma chain/FCER1G, likely through its interaction with CLEC4E, in myeloid cells. Binding of TDM or C. albicans alpha-mannans to this receptor complex induces the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, activating SYK, CARD9, and NF-kappa-B. This activation drives the maturation of antigen-presenting cells and influences antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. CLEC4D, when forming a heterodimer with CLEC6A, exhibits activity against fungal infections. Additionally, it functions as an endocytic receptor, suggesting a role in antigen uptake at the site of infection, either for antigen clearance or for processing and subsequent presentation to T-cells. The heterodimerization with CLEC4E and CLEC6A further highlights the dynamic and versatile nature of CLEC4D in immune surveillance and response mechanisms.

Species

Human

Source

HEK293

Tag

N-His

Accession

Q8WXI8 (G52-N215)

Gene ID
Molecular Construction
N-term
His
CLEC4D (G52-N215)
Accession # Q8WXI8
C-term
Protein Length

Partial

Synonyms
C-type lectin domain family 4 member D; CLEC-6; Dectin-3; CD368; CLECSF8
AA Sequence

GTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

Molecular Weight

21-27 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CLEC4D Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CLEC4D Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC4D Protein, Human (HEK293, His)
Cat. No.:
HY-P76834
Quantity:
MCE Japan Authorized Agent: