CLEC4D Protein, Human (HEK293, His)
The CLEC4D protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system, recognizing DAMPs and PAMPs on bacteria and fungi. It forms a functional complex with FCER1G in myeloid cells, triggering immune activation. CLEC4D Protein, Human (HEK293, His) is the recombinant human-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The CLEC4D protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system, recognizing DAMPs and PAMPs on bacteria and fungi. It forms a functional complex with FCER1G in myeloid cells, triggering immune activation. CLEC4D Protein, Human (HEK293, His) is the recombinant human-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.
Background
CLEC4D, a calcium-dependent lectin, operates as a pattern recognition receptor (PRR) in the innate immune system, discerning both damage-associated molecular patterns (DAMPs) and pathogen-associated molecular patterns (PAMPs) from bacteria and fungi. Recognizing alpha-mannans on C. albicans hyphae and mycobacterial trehalose 6,6'-dimycolate (TDM), CLEC4D forms a functional complex with the signaling adapter Fc receptor gamma chain/FCER1G, likely through its interaction with CLEC4E, in myeloid cells. Binding of TDM or C. albicans alpha-mannans to this receptor complex induces the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, activating SYK, CARD9, and NF-kappa-B. This activation drives the maturation of antigen-presenting cells and influences antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes. CLEC4D, when forming a heterodimer with CLEC6A, exhibits activity against fungal infections. Additionally, it functions as an endocytic receptor, suggesting a role in antigen uptake at the site of infection, either for antigen clearance or for processing and subsequent presentation to T-cells. The heterodimerization with CLEC4E and CLEC6A further highlights the dynamic and versatile nature of CLEC4D in immune surveillance and response mechanisms.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q8WXI8 (G52-N215)
-
Molecular Construction
-
N-term
-
His
-
CLEC4D (G52-N215)
Accession # Q8WXI8 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CLEC4D; C-Type Lectin-Like Receptor 6; Prev. CLECSF8; Dectin 3; Dectin-3; CLEC-6; MCL; C-Type Lectin Domain Family 4, Member D; CD368; Macrophage C-Type Lectin; Mpcl; C-Type Lectin Receptor; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lect
-
AA Sequence
GTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
-
Predicted Molecular Mass
21.2 kDa
-
Molecular Weight
Approximately 21-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)