CLEC4D Protein, Rat (HEK293, His)

CLEC4D, a calcium-dependent lectin, detects DAMPs and PAMPs from bacteria and fungi. It interacts with FCER1G in myeloid cells, forming a functional complex that activates signaling pathways and promotes antigen-presenting cell maturation and T-cell priming. CLEC4D also combats fungal infections and contributes to antigen uptake for clearance or presentation to T-cells. Its interaction with CLEC4E strengthens the interaction with FCER1G. CLEC4D Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

CLEC4D, a calcium-dependent lectin, serves as a pivotal pattern recognition receptor (PRR) within the innate immune system, identifying damage-associated molecular patterns (DAMPs) and pathogen-associated molecular patterns (PAMPs) from bacteria and fungi. Notably, it recognizes alpha-mannans on C.albicans hyphae and mycobacterial trehalose 6,6'-dimycolate (TDM). In myeloid cells, CLEC4D interacts with the signaling adapter Fc receptor gamma chain/FCER1G, likely facilitated by CLEC4E, forming a functional complex. Binding of mycobacterial TDM or C.albicans alpha-mannans to this receptor complex triggers phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, activating SYK, CARD9, and NF-kappa-B. This activation cascade drives maturation of antigen-presenting cells, shaping antigen-specific priming of T-cells towards effector T-helper 1 and T-helper 17 cell subtypes. Additionally, the CLEC4D-CLEC6A heterodimer actively combats fungal infections, while CLEC4D, functioning as an endocytic receptor, may contribute to antigen uptake at infection sites for either antigen clearance or processing and subsequent presentation to T-cells. The disulfide-linked heterodimer with CLEC4E reinforces interaction with FCER1G, forming a functional complex.

Immobilized Trehalose 6, 6'-Dimycolate at 1μg/mL (100μL/well) can bind Rat CLEC4D Protein. The ED₅₀ for this effect is 0.08169 μg/mL.

• 
  Immobilized Trehalose 6, 6'-Dimycolate at 1 μg/mL (100 μL/well) can bind Rat CLEC4D Protein. The ED₅₀ for this effect is 0.08169 μg/mL.

Rat

HEK293

N-6*His

Q69FH1 (W48-K218)

362432  [NCBI]

Extracellular Domain

WKRGSALKFSDYHTRLTCILEEPQPGATGGTWTCCPVSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVDKTPFNPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVWNDFPCHFEMGRICKLPGATFDWNPSK

Approximately 23-30 kDa due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.