CLEC4D Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

CLEC4D, a calcium-dependent lectin, detects DAMPs and PAMPs from bacteria and fungi. It interacts with FCER1G in myeloid cells, forming a functional complex that activates signaling pathways and promotes antigen-presenting cell maturation and T-cell priming. CLEC4D also combats fungal infections and contributes to antigen uptake for clearance or presentation to T-cells. Its interaction with CLEC4E strengthens the interaction with FCER1G. CLEC4D Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CLEC4D, a calcium-dependent lectin, detects DAMPs and PAMPs from bacteria and fungi. It interacts with FCER1G in myeloid cells, forming a functional complex that activates signaling pathways and promotes antigen-presenting cell maturation and T-cell priming. CLEC4D also combats fungal infections and contributes to antigen uptake for clearance or presentation to T-cells. Its interaction with CLEC4E strengthens the interaction with FCER1G. CLEC4D Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC4D protein, expressed by HEK293 , with N-His labeled tag.

Background

CLEC4D, a calcium-dependent lectin, serves as a pivotal pattern recognition receptor (PRR) within the innate immune system, identifying damage-associated molecular patterns (DAMPs) and pathogen-associated molecular patterns (PAMPs) from bacteria and fungi. Notably, it recognizes alpha-mannans on C.albicans hyphae and mycobacterial trehalose 6,6'-dimycolate (TDM). In myeloid cells, CLEC4D interacts with the signaling adapter Fc receptor gamma chain/FCER1G, likely facilitated by CLEC4E, forming a functional complex. Binding of mycobacterial TDM or C.albicans alpha-mannans to this receptor complex triggers phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, activating SYK, CARD9, and NF-kappa-B. This activation cascade drives maturation of antigen-presenting cells, shaping antigen-specific priming of T-cells towards effector T-helper 1 and T-helper 17 cell subtypes. Additionally, the CLEC4D-CLEC6A heterodimer actively combats fungal infections, while CLEC4D, functioning as an endocytic receptor, may contribute to antigen uptake at infection sites for either antigen clearance or processing and subsequent presentation to T-cells. The disulfide-linked heterodimer with CLEC4E reinforces interaction with FCER1G, forming a functional complex.

Verified Bioactivity

Immobilized Trehalose 6, 6'-Dimycolate at 1μg/mL (100μL/well) can bind Rat CLEC4D Protein. The ED50 for this effect is 0.08169 μg/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CLEC4D (W48-K218)
      Accession # Q69FH1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC4D; C-Type Lectin-Like Receptor 6; Prev. CLECSF8; Dectin 3; Dectin-3; CLEC-6; MCL; C-Type Lectin Domain Family 4, Member D; CD368; Macrophage C-Type Lectin; Mpcl; C-Type Lectin Receptor; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lect

  • AA Sequence

    WKRGSALKFSDYHTRLTCILEEPQPGATGGTWTCCPVSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVDKTPFNPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVWNDFPCHFEMGRICKLPGATFDWNPSK

  • Molecular Weight

    Approximately 29 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00