1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. MDL-1/CLEC5A
  6. CLEC5A/MDL-1 Protein, Human (HEK293, His)

The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Human (HEK293, His) is the recombinant human-derived CLEC5A/MDL-1 protein, expressed by HEK293, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CLEC5A/MDL-1 protein positively regulates osteoclastogenesis and regulates inflammatory responses. It acts as a critical macrophage receptor for dengue virus serotypes 1-4, triggering signaling through TYROBP phosphorylation. This interaction stimulates the release of pro-inflammatory cytokines without viral entry. CLEC5A/MDL-1 Protein, Human (HEK293, His) is the recombinant human-derived CLEC5A/MDL-1 protein, expressed by HEK293, with N-His labeled tag.

Background

CLEC5A/MDL-1 functions as a positive regulator of osteoclastogenesis and serves as a cell surface receptor that signals through TYROBP, thereby modulating inflammatory responses. In the context of microbial infection, particularly as a critical macrophage receptor for dengue virus serotypes 1-4, CLEC5A plays a crucial role. The interaction between dengue virus and CLEC5A leads to signaling events involving the phosphorylation of TYROBP, which, interestingly, does not facilitate viral entry but rather induces the release of pro-inflammatory cytokines.

Biological Activity

Human Galectin-9 immobilized on CM5 Chip can bind Human CLEC5A, His Tag with an affinity constant of 68.9 pM as determined in a SPR assay.

Species

Human

Source

HEK293

Tag

N-His

Accession

Q9NY25-1 (P28-K188)

Gene ID

23601

Molecular Construction
N-term
His
CLEC5A/MDL-1 (P28-K188)
Accession # Q9NY25
C-term
Protein Length

Extracellular Domain

Synonyms
MDL-1; CLECSF5; MDL1; CLEC5A; DAP12-associating lectin 1
AA Sequence

PQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK

Predicted Molecular Mass
39.0 kDa
Molecular Weight

Approximately 60-66 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CLEC5A/MDL-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CLEC5A/MDL-1 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC5A/MDL-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P704543
Quantity:
MCE Japan Authorized Agent: