CLEC5A/MDL-1 Protein, Mouse (Biotinylated, HEK293, His, Avi)

CLEC5A/MDL-1 Protein positively regulates osteoclastogenesis and acts as a cell surface receptor signaling via TYROBP. Its expression relies on the TYROBP interaction and it plays a role in regulating inflammatory responses. CLEC5A/TYROBP/HCST complex formation highlights its intricate involvement in immune and inflammatory processes. CLEC5A/MDL-1 Protein, Mouse (Biotinylated, HEK293, His, Avi) is the recombinant mouse-derived CLEC5A/MDL-1 protein, expressed by HEK293, with N-Avi and N-His labeled tag.

CLEC5A/MDL-1 Protein acts as a positive regulator of osteoclastogenesis and functions as a cell surface receptor that signals via TYROBP. This interaction is vital for CLEC5A cell surface expression. Additionally, the protein plays a role in regulating inflammatory responses. While existing as a monomer or homodimer, the majority of CLEC5A is expressed as a monomeric form on macrophages. It forms a trimolecular complex, CLEC5A/TYROBP/HCST, mainly dependent on TYROBP. The interaction with TYROBP and HCST further underscores the intricate signaling network involved in the functions of CLEC5A in immune and inflammatory processes.

Mouse

HEK293

N-Avi;N-8*His

Q9R007-3 (Y26-K190)

23845

Extracellular Domain

Biotin

YFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK

Approximately 35-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.