Copy Link Print Information

CLEC5A/MDL-1 Protein, Mouse (Biotinylated, HEK293, His, Avi)

Customer Review

Based on 1 Customer Validation

CLEC5A/MDL-1 Protein positively regulates osteoclastogenesis and acts as a cell surface receptor signaling via TYROBP. Its expression relies on the TYROBP interaction and it plays a role in regulating inflammatory responses. CLEC5A/TYROBP/HCST complex formation highlights its intricate involvement in immune and inflammatory processes. CLEC5A/MDL-1 Protein, Mouse (Biotinylated, HEK293, His, Avi) is the recombinant mouse-derived CLEC5A/MDL-1 protein, expressed by HEK293, with N-Avi and N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CLEC5A/MDL-1 Protein, Mouse (Biotinylated, HEK293, His, Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CLEC5A/MDL-1 Protein positively regulates osteoclastogenesis and acts as a cell surface receptor signaling via TYROBP. Its expression relies on the TYROBP interaction and it plays a role in regulating inflammatory responses. CLEC5A/TYROBP/HCST complex formation highlights its intricate involvement in immune and inflammatory processes. CLEC5A/MDL-1 Protein, Mouse (Biotinylated, HEK293, His, Avi) is the recombinant mouse-derived CLEC5A/MDL-1 protein, expressed by HEK293, with N-Avi and N-His labeled tag.

Background

CLEC5A/MDL-1 Protein acts as a positive regulator of osteoclastogenesis and functions as a cell surface receptor that signals via TYROBP. This interaction is vital for CLEC5A cell surface expression. Additionally, the protein plays a role in regulating inflammatory responses. While existing as a monomer or homodimer, the majority of CLEC5A is expressed as a monomeric form on macrophages. It forms a trimolecular complex, CLEC5A/TYROBP/HCST, mainly dependent on TYROBP. The interaction with TYROBP and HCST further underscores the intricate signaling network involved in the functions of CLEC5A in immune and inflammatory processes.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-Avi;N-8*His
  • Accession

    Q9R007-3 (Y26-K190)

  • Gene ID
    23845
  • Molecular Construction
    • N-term
    • 8*His-Avi
    • CLEC5A/MDL-1 (Y26-K190)
      Accession # Q9R007-3
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    CLEC5A; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 5; Prev. CLECSF5; MDL1; C-Type Lectin Domain Family 5 Member A; C-Type Lectin Domain Family 5, Member A; MDL-1; Myeloid DAP12-Associating Lectin-1; C-Type Lecti

  • AA Sequence

    YFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK

  • Predicted Molecular Mass

    21.8 kDa

  • Molecular Weight

    Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CLEC5A/MDL-1 Protein, Mouse (Biotinylated, HEK293, His, Avi) Product Image
    1/16
  • CLEC5A/MDL-1 Protein, Mouse (Biotinylated, HEK293, His, Avi) Product Image