CNPY3/PRAT4A Protein, Mouse (HEK293, His)

The CNPY3/PRAT4A protein is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for the correct folding and exit of TLRs (excluding TLR3) from the endoplasmic reticulum. CNPY3/PRAT4A is critical for innate and adaptive immune responses, interacts with HSP90B1, and is destroyed in the presence of ATP. CNPY3/PRAT4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-His labeled tag.

CNPY3/PRAT4A Protein functions as a Toll-like receptor (TLR)-specific co-chaperone for HSP90B1, playing a vital role in the proper folding of TLRs, with the exception of TLR3, and thereby controlling their exit from the endoplasmic reticulum. This protein's involvement is critical for both innate and adaptive immune responses. CNPY3/PRAT4A interacts with HSP90B1, and this interaction is disrupted in the presence of ATP. Furthermore, it engages with various TLRs, including TLR1, TLR2, TLR4, and TLR9, with the strongest interaction observed with TLR4. The intricate interplay between CNPY3/PRAT4A and TLRs underscores its significance in regulating immune responses and highlights its role as a co-chaperone in the cellular mechanisms that govern the proper folding and trafficking of TLRs.

Mouse

HEK293

C-His

Q9DAU1-1 (A27-P272)

72029  [NCBI]

Partial

APKLGPSPAGAEETDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDGKGSGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAERWSGKKGDIASLGGKKSKKKRSGVKGSSSGSSKQRKELGGLGEDANAEEEEGVQKASPLPHSP

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.