CNPY3/PRAT4A Protein, Mouse (HEK293, His)
The CNPY3/PRAT4A protein is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for the correct folding and exit of TLRs (excluding TLR3) from the endoplasmic reticulum. CNPY3/PRAT4A is critical for innate and adaptive immune responses, interacts with HSP90B1, and is destroyed in the presence of ATP. CNPY3/PRAT4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CNPY3/PRAT4A protein is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for the correct folding and exit of TLRs (excluding TLR3) from the endoplasmic reticulum. CNPY3/PRAT4A is critical for innate and adaptive immune responses, interacts with HSP90B1, and is destroyed in the presence of ATP. CNPY3/PRAT4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-His labeled tag.
Background
CNPY3/PRAT4A Protein functions as a Toll-like receptor (TLR)-specific co-chaperone for HSP90B1, playing a vital role in the proper folding of TLRs, with the exception of TLR3, and thereby controlling their exit from the endoplasmic reticulum. This protein's involvement is critical for both innate and adaptive immune responses. CNPY3/PRAT4A interacts with HSP90B1, and this interaction is disrupted in the presence of ATP. Furthermore, it engages with various TLRs, including TLR1, TLR2, TLR4, and TLR9, with the strongest interaction observed with TLR4. The intricate interplay between CNPY3/PRAT4A and TLRs underscores its significance in regulating immune responses and highlights its role as a co-chaperone in the cellular mechanisms that govern the proper folding and trafficking of TLRs.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9DAU1-1 (A27-P272)
-
Molecular Construction
-
N-term
-
CNPY3 (A27-P272)
Accession # Q9DAU1-1 -
His
-
C-term
-
-
Protein Length
Full Length of Protein canopy homolog 3 Chain
-
Synonyms
CNPY3; PRAT4A; Prev. TNRC5; Protein Associated With Toll-Like Receptor 4A; CAG4A; Trinucleotide Repeat Containing 5; Trinucleotide Repeat-Containing Gene 5 Protein; Canopy 3 Homolog (Zebrafish); Expanded Repeat-Domain Protein CAG/CTG 5; CAG Repeat Contain
-
AA Sequence
APKLGPSPAGAEETDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDGKGSGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAERWSGKKGDIASLGGKKSKKKRSGVKGSSSGSSKQRKELGGLGEDANAEEEEGVQKASPLPHSP
-
Predicted Molecular Mass
28.6 kDa
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
