1. Recombinant Proteins
  2. Others
  3. CNPY3/PRAT4A Protein, Mouse (HEK293, His)

The CNPY3/PRAT4A protein is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for the correct folding and exit of TLRs (excluding TLR3) from the endoplasmic reticulum. CNPY3/PRAT4A is critical for innate and adaptive immune responses, interacts with HSP90B1, and is destroyed in the presence of ATP. CNPY3/PRAT4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CNPY3/PRAT4A protein is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for the correct folding and exit of TLRs (excluding TLR3) from the endoplasmic reticulum. CNPY3/PRAT4A is critical for innate and adaptive immune responses, interacts with HSP90B1, and is destroyed in the presence of ATP. CNPY3/PRAT4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-His labeled tag.

Background

CNPY3/PRAT4A Protein functions as a Toll-like receptor (TLR)-specific co-chaperone for HSP90B1, playing a vital role in the proper folding of TLRs, with the exception of TLR3, and thereby controlling their exit from the endoplasmic reticulum. This protein's involvement is critical for both innate and adaptive immune responses. CNPY3/PRAT4A interacts with HSP90B1, and this interaction is disrupted in the presence of ATP. Furthermore, it engages with various TLRs, including TLR1, TLR2, TLR4, and TLR9, with the strongest interaction observed with TLR4. The intricate interplay between CNPY3/PRAT4A and TLRs underscores its significance in regulating immune responses and highlights its role as a co-chaperone in the cellular mechanisms that govern the proper folding and trafficking of TLRs.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9DAU1-1 (A27-P272)

Gene ID
Molecular Construction
N-term
CNPY3 (A27-P272)
Accession # Q9DAU1-1
His
C-term
Protein Length

Partial

Synonyms
Protein canopy homolog 3; Protein associated with Tlr4; PRAT4A; TNRC5
AA Sequence

APKLGPSPAGAEETDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDGKGSGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAERWSGKKGDIASLGGKKSKKKRSGVKGSSSGSSKQRKELGGLGEDANAEEEEGVQKASPLPHSP

Predicted Molecular Mass
28.6 kDa
Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CNPY3/PRAT4A Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CNPY3/PRAT4A Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CNPY3/PRAT4A Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76274
Quantity:
MCE Japan Authorized Agent: