Complement C5a Protein, Human (His)

Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Human (His) is the recombinant human-derived Complement C5/C5a protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Human (His) is the recombinant human-derived Complement C5/C5a protein, expressed by E. coli , with N-His labeled tag.

Background

Upon activation by a C5 convertase, Complement C5 initiates the spontaneous assembly of the late complement components, C5-C9, forming the membrane attack complex. The transient binding site for C6 on C5b is crucial for the foundation of the lytic complex. The proteolytic degradation of complement C5 produces C5a anaphylatoxin, a mediator of local inflammatory processes. C5a interacts with its receptor C5AR1, triggering diverse responses such as intracellular calcium release, smooth muscle contraction, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. Acting as a potent chemokine, C5a stimulates the locomotion of polymorphonuclear leukocytes and guides their migration toward sites of inflammation, contributing to the orchestration of immune responses.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • C5a (T678-R751)
      Accession # P01031
    • C-term
  • Protein Length

    Full Length of C5a anaphylatoxin Chain

  • Synonyms

    C5; C3 And PZP-Like Alpha-2-Macroglobulin Domain-Containing Protein 4; Complement C5; C5a Anaphylatoxin; CPAMD4; Prepro-C5; Complement Component 5; Anaphylatoxin C5a Analog; C5a; ECLZB; C5b; C5D

  • AA Sequence

    TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

  • Predicted Molecular Mass

    9.4 kDa

  • Molecular Weight

    Approximately 13-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00