Complement C5a Protein, Human (His)
Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Human (His) is the recombinant human-derived Complement C5/C5a protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Complement C5 is activated by C5 convertase, inducing C5-C9 assembly to form the membrane attack complex. The transient C6 binding site on C5b is critical for the formation of the cleavage complex. Complement C5a Protein, Human (His) is the recombinant human-derived Complement C5/C5a protein, expressed by E. coli , with N-His labeled tag.
Upon activation by a C5 convertase, Complement C5 initiates the spontaneous assembly of the late complement components, C5-C9, forming the membrane attack complex. The transient binding site for C6 on C5b is crucial for the foundation of the lytic complex. The proteolytic degradation of complement C5 produces C5a anaphylatoxin, a mediator of local inflammatory processes. C5a interacts with its receptor C5AR1, triggering diverse responses such as intracellular calcium release, smooth muscle contraction, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. Acting as a potent chemokine, C5a stimulates the locomotion of polymorphonuclear leukocytes and guides their migration toward sites of inflammation, contributing to the orchestration of immune responses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-8*His
-
Accession
P01031 (T678-R751)
-
Molecular Construction
-
N-term
-
8*His
-
C5a (T678-R751)
Accession # P01031 -
C-term
-
-
Protein Length
Partial
-
Synonyms
C5; C3 And PZP-Like Alpha-2-Macroglobulin Domain-Containing Protein 4; Complement C5; C5a Anaphylatoxin; CPAMD4; Prepro-C5; Complement Component 5; Anaphylatoxin C5a Analog; C5a; ECLZB; C5b; C5D
-
AA Sequence
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
-
Predicted Molecular Mass
9.4 kDa
-
Molecular Weight
Approximately 13-14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
