Complement Factor D/Adipsin Protein, Rat (P.pastoris, His)
Based on 1 Customer Validation
Complement Factor D/Adipsin Protein is pivotal, cleaving factor B within the factor C3b complex to activate the C3bbb complex, serving as the C3 convertase in the alternate pathway—analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is the recombinant rat-derived Complement Factor D/Adipsin protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Rat
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Complement Factor D/Adipsin Protein is pivotal, cleaving factor B within the factor C3b complex to activate the C3bbb complex, serving as the C3 convertase in the alternate pathway—analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is the recombinant rat-derived Complement Factor D/Adipsin protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
Complement Factor D/Adipsin Protein performs a crucial role by cleaving factor B when it is in complex with factor C3b. This cleavage triggers the activation of the C3bbb complex, subsequently forming the C3 convertase of the alternate pathway. Importantly, its function is analogous to that of C1s in the classical pathway.
Technical Parameters
-
Species Rat
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P32038 (I26-A263)
-
Molecular Construction
-
N-term
-
6*His
-
CFD (I26-A263)
Accession # P32038 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CFD; C3 Convertase Activator; Prev. PFD; D Component Of Complement (Adipsin); Prev. DF; Complement Factor D Preproprotein; Properdin Factor D; Complement Factor D (Adipsin); Adipsin; Complement Factor D; ADN
-
AA Sequence
ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
-
Predicted Molecular Mass
27.8 kDa
-
Molecular Weight
Approximately 43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)