Complement Factor D/Adipsin Protein, Rat (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

Complement Factor D/Adipsin Protein is pivotal, cleaving factor B within the factor C3b complex to activate the C3bbb complex, serving as the C3 convertase in the alternate pathway—analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is the recombinant rat-derived Complement Factor D/Adipsin protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Complement Factor D/Adipsin Protein is pivotal, cleaving factor B within the factor C3b complex to activate the C3bbb complex, serving as the C3 convertase in the alternate pathway—analogous to C1s in the classical pathway. Complement Factor D/Adipsin Protein, Rat (P.pastoris, His) is the recombinant rat-derived Complement Factor D/Adipsin protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

Complement Factor D/Adipsin Protein performs a crucial role by cleaving factor B when it is in complex with factor C3b. This cleavage triggers the activation of the C3bbb complex, subsequently forming the C3 convertase of the alternate pathway. Importantly, its function is analogous to that of C1s in the classical pathway.

Technical Parameters

  • Species Rat
  • Source P. pastoris
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CFD (I26-A263)
      Accession # P32038
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CFD; C3 Convertase Activator; Prev. PFD; D Component Of Complement (Adipsin); Prev. DF; Complement Factor D Preproprotein; Properdin Factor D; Complement Factor D (Adipsin); Adipsin; Complement Factor D; ADN

  • AA Sequence

    ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

  • Predicted Molecular Mass

    27.8 kDa

  • Molecular Weight

    Approximately 43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00