Complement factor H/CFH Protein, Human (372a.a, HEK293, His)

Customer Review

Based on 1 Customer Validation

Complement factor H/CFH proteins regulate complement activation and act as soluble inhibitors to prevent complement amplification on the cell surface. Complement factor H/CFH Protein, Human (372a.a, HEK293, His) is the recombinant human-derived Complement factor H/CFH protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Complement factor H/CFH proteins regulate complement activation and act as soluble inhibitors to prevent complement amplification on the cell surface. Complement factor H/CFH Protein, Human (372a.a, HEK293, His) is the recombinant human-derived Complement factor H/CFH protein, expressed by HEK293 , with C-His labeled tag.

Background

Complement factor H (CFH) Protein, a glycoprotein, assumes a critical role in orchestrating a balanced immune response by finely modulating complement activation. Functioning as a soluble inhibitor, CFH's binding to self markers, such as glycan structures, effectively prevents complement activation and amplification on cell surfaces. It acts to accelerate the decay of the complement alternative pathway (AP) C3 convertase C3bBb, thus impeding the local formation of more C3b, a pivotal component in the complement amplification loop. Serving as a cofactor for the serine protease factor I, CFH additionally regulates the proteolytic degradation of already-deposited C3b. Beyond its role in complement regulation, CFH mediates various cellular responses through interactions with specific receptors. For instance, it engages with the CR3/ITGAM receptor, facilitating the adhesion of human neutrophils to diverse pathogens, leading to subsequent phagocytosis and destruction. Notably, in the context of microbial infection, CFH binds to the surface of P.falciparum gametocytes in the mosquito midgut, offering protection against elimination mediated by the alternative complement pathway. The multifaceted activities of CFH underscore its pivotal role in immune regulation and defense against pathogens.

Verified Bioactivity

Measured by its ability to bind biotinylated human DMP-1 in a functional ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CFH (S860-R1231)
      Accession # P08603-1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Complement factor H; H factor 1; CFH; HF; HF1; HF2

  • AA Sequence

    SIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR

  • Predicted Molecular Mass

    43 kDa

  • Molecular Weight

    Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL