COMT Protein, Human (sf9, His)
Catechol-O-methyltransferase (COMT) plays a crucial role by catalyzing and inactivating the O-methylation of catecholamine neurotransmitters and catechol hormones. This enzyme activity is critical for regulating the biological half-life of key neuroactive compounds, including catecholamines. COMT Protein, Human (sf9, His) is the recombinant human-derived COMT protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Catechol-O-methyltransferase (COMT) plays a crucial role by catalyzing and inactivating the O-methylation of catecholamine neurotransmitters and catechol hormones. This enzyme activity is critical for regulating the biological half-life of key neuroactive compounds, including catecholamines. COMT Protein, Human (sf9, His) is the recombinant human-derived COMT protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Catechol-O-methyltransferase (COMT) is a crucial enzyme that catalyzes the O-methylation and subsequent inactivation of catecholamine neurotransmitters and catechol hormones. By mediating the transfer of a methyl group to these molecules, COMT plays a pivotal role in regulating the levels and activity of neurotransmitters such as dopamine, epinephrine, and norepinephrine. Beyond its involvement in catecholamine metabolism, COMT also shortens the biological half-lives of specific neuroactive drugs, including L-DOPA, alpha-methyl DOPA, and isoproterenol. This enzymatic activity is significant in modulating the pharmacokinetics of therapeutic agents targeting neurological and hormonal pathways. The regulatory role of COMT in both endogenous neurotransmitters and exogenous drugs highlights its importance in the fine-tuning of neurotransmission and drug responses, showcasing its broad impact on physiological and pharmacological processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P21964 (M51-P271)
-
Molecular Construction
-
N-term
-
COMT (M51-P271)
Accession # P21964 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
COMT; Catechol-O-Methyltransferase Isoform; Catechol-O-Methyltransferase; Testicular Tissue Protein Li 42; Catechol O-Methyltransferase; HEL-S-98n; Epididymis Secretory Sperm Binding Protein Li 98n
-
AA Sequence
MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
-
Predicted Molecular Mass
31.5 kDa
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
