1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. COMT Protein, Human (sf9, His)

Catechol-O-methyltransferase (COMT) plays a crucial role by catalyzing and inactivating the O-methylation of catecholamine neurotransmitters and catechol hormones. This enzyme activity is critical for regulating the biological half-life of key neuroactive compounds, including catecholamines. COMT Protein, Human (sf9, His) is the recombinant human-derived COMT protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Catechol-O-methyltransferase (COMT) plays a crucial role by catalyzing and inactivating the O-methylation of catecholamine neurotransmitters and catechol hormones. This enzyme activity is critical for regulating the biological half-life of key neuroactive compounds, including catecholamines. COMT Protein, Human (sf9, His) is the recombinant human-derived COMT protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Catechol-O-methyltransferase (COMT) is a crucial enzyme that catalyzes the O-methylation and subsequent inactivation of catecholamine neurotransmitters and catechol hormones. By mediating the transfer of a methyl group to these molecules, COMT plays a pivotal role in regulating the levels and activity of neurotransmitters such as dopamine, epinephrine, and norepinephrine. Beyond its involvement in catecholamine metabolism, COMT also shortens the biological half-lives of specific neuroactive drugs, including L-DOPA, alpha-methyl DOPA, and isoproterenol. This enzymatic activity is significant in modulating the pharmacokinetics of therapeutic agents targeting neurological and hormonal pathways. The regulatory role of COMT in both endogenous neurotransmitters and exogenous drugs highlights its importance in the fine-tuning of neurotransmission and drug responses, showcasing its broad impact on physiological and pharmacological processes.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

P21964 (M51-P271)

Gene ID
Molecular Construction
N-term
COMT (M51-P271)
Accession # P21964
His
C-term
Protein Length

Partial

Synonyms
Catechol O-methyltransferase; COMT
AA Sequence

MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Predicted Molecular Mass
31.5 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

COMT Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

COMT Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COMT Protein, Human (sf9, His)
Cat. No.:
HY-P74230
Quantity:
MCE Japan Authorized Agent: