CRACC/SLAMF7 Protein, Human (HEK293, His-Avi)

The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that complexly regulates immune cell activation and differentiation through finely regulated interactions. Isoform 1 mediates NK cell activation through an SH2D1A-independent ERK-mediated pathway and positively regulates NK cell function dependent on phosphorylated SH2D1B. CRACC/SLAMF7 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

The CRACC/SLAMF7 protein, as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, participates in homo- or heterotypic cell-cell interactions that modulate the activation and differentiation of various immune cells, intricately contributing to the regulation and interconnection of both innate and adaptive immune responses. The protein's activities are finely tuned by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. Specifically, isoform 1 of CRACC/SLAMF7 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway, positively regulating NK cell functions in a mechanism dependent on phosphorylated SH2D1B. Downstream signaling involves PLCG1, PLCG2, and PI3K. Additionally, homotypic interactions between NK cells may contribute to activation, but in the absence of SH2D1B, CRACC/SLAMF7 inhibits NK cell function. The protein also acts as an inhibitory factor in T-cells and may play a role in lymphocyte adhesion. In LPS-activated monocytes, it negatively regulates the production of pro-inflammatory cytokines. However, isoform 3 of CRACC/SLAMF7 does not mediate any NK cell activation, indicating isoform-specific functional differences in immune modulation.

Human

HEK293

C-Avi;C-8*His

Q9NQ25-1 (S23-M226)

57823  [NCBI]

Extracellular Domain

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

Approximately 40-55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.