CREB3L1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

CREB3L1 protein is located on the endoplasmic reticulum membrane and is converted into a transcription factor processing cyclic AMP response element binding protein 3-like protein 1. During endoplasmic reticulum stress or DNA damage, it translocates to the Golgi apparatus, is cleaved by S1P/MBTPS1 and S2P/MBTPS2, and releases a cytoplasmic domain that activates gene transcription in the nucleus. CREB3L1 Protein, Human (HEK293, His) is the recombinant human-derived CREB3L1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CREB3L1 protein is located on the endoplasmic reticulum membrane and is converted into a transcription factor processing cyclic AMP response element binding protein 3-like protein 1. During endoplasmic reticulum stress or DNA damage, it translocates to the Golgi apparatus, is cleaved by S1P/MBTPS1 and S2P/MBTPS2, and releases a cytoplasmic domain that activates gene transcription in the nucleus. CREB3L1 Protein, Human (HEK293, His) is the recombinant human-derived CREB3L1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CREB3L1 protein serves as the precursor for the transcription factor form, Processed cyclic AMP-responsive element-binding protein 3-like protein 1, embedded in the endoplasmic reticulum (ER) membrane with its N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic face of the membrane. In response to ER stress or DNA damage, CREB3L1 is transported to the Golgi, where it undergoes site-specific cleavage by resident proteases S1P/MBTPS1 and S2P/MBTPS2. The resulting N-terminal cytosolic domain is translocated to the nucleus, activating transcription of specific target genes involved in cell-cycle progression inhibition. This transcription factor plays a crucial role in cell type-specific DNA damage and the unfolded protein response (UPR), binding to the DNA consensus sequence 5'-GTGXGCXGC-3'. In bone formation, CREB3L1 regulates COL1A1 and possibly COL1A2 transcription, contributing to the secretion of bone matrix proteins. Additionally, it protects astrocytes from ER stress-induced cell death by binding to the cAMP response element (CRE) of the BiP/HSPA5 promoter. In astrocytes and osteoblasts, CREB3L1 inhibits cell-cycle progression after G2/M phase upon DNA damage by activating transcription of cell-cycle inhibitors like p21/CDKN1A. Furthermore, it is required for TGFB1 to activate genes involved in the assembly of collagen extracellular matrix.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CREB3L1 (E396-S519)
      Accession # Q96BA8-1
    • His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    CREB3L1; Osteogenesis Imperfecta, Type XVI; CAMP Responsive Element Binding Protein 3 Like 1; BBF-2 Homolog (Drosophila); OASIS; BBF-2 Homolog; Cyclic AMP-Responsive Element-Binding Protein 3-Like Protein 1; C16DELp11.2; CAMP-Responsive Element-Binding Pr

  • AA Sequence

    EFSSGSQTVKEDPLAADGVYTASQMPSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTKYLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS

  • Predicted Molecular Mass

    15.2 kDa

  • Molecular Weight

    Approximately 21-31 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, PH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00