1. Recombinant Proteins
  2. Others
  3. CREB3L1 Protein, Human (HEK293, His)

CREB3L1 protein is located on the endoplasmic reticulum membrane and is converted into a transcription factor processing cyclic AMP response element binding protein 3-like protein 1. During endoplasmic reticulum stress or DNA damage, it translocates to the Golgi apparatus, is cleaved by S1P/MBTPS1 and S2P/MBTPS2, and releases a cytoplasmic domain that activates gene transcription in the nucleus. CREB3L1 Protein, Human (HEK293, His) is the recombinant human-derived CREB3L1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CREB3L1 protein is located on the endoplasmic reticulum membrane and is converted into a transcription factor processing cyclic AMP response element binding protein 3-like protein 1. During endoplasmic reticulum stress or DNA damage, it translocates to the Golgi apparatus, is cleaved by S1P/MBTPS1 and S2P/MBTPS2, and releases a cytoplasmic domain that activates gene transcription in the nucleus. CREB3L1 Protein, Human (HEK293, His) is the recombinant human-derived CREB3L1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CREB3L1 protein serves as the precursor for the transcription factor form, Processed cyclic AMP-responsive element-binding protein 3-like protein 1, embedded in the endoplasmic reticulum (ER) membrane with its N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic face of the membrane. In response to ER stress or DNA damage, CREB3L1 is transported to the Golgi, where it undergoes site-specific cleavage by resident proteases S1P/MBTPS1 and S2P/MBTPS2. The resulting N-terminal cytosolic domain is translocated to the nucleus, activating transcription of specific target genes involved in cell-cycle progression inhibition. This transcription factor plays a crucial role in cell type-specific DNA damage and the unfolded protein response (UPR), binding to the DNA consensus sequence 5'-GTGXGCXGC-3'. In bone formation, CREB3L1 regulates COL1A1 and possibly COL1A2 transcription, contributing to the secretion of bone matrix proteins. Additionally, it protects astrocytes from ER stress-induced cell death by binding to the cAMP response element (CRE) of the BiP/HSPA5 promoter. In astrocytes and osteoblasts, CREB3L1 inhibits cell-cycle progression after G2/M phase upon DNA damage by activating transcription of cell-cycle inhibitors like p21/CDKN1A. Furthermore, it is required for TGFB1 to activate genes involved in the assembly of collagen extracellular matrix.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q96BA8-1 (E396-S519)

Gene ID
Molecular Construction
N-term
CREB3L1 (E396-S519)
Accession # Q96BA8-1
His
C-term
Protein Length

Lumenal Domain

Synonyms
Cyclic AMP-responsive element-binding protein 3-like protein 1; OASIS
AA Sequence

EFSSGSQTVKEDPLAADGVYTASQMPSRSLLFYDDGAGLWEDGRSTLLPMEPPDGWEINPGGPAEQRPRDHLQHDHLDSTHETTKYLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS

Molecular Weight

21-31 kDa.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, PH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

CREB3L1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CREB3L1 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CREB3L1 Protein, Human (HEK293, His)
Cat. No.:
HY-P76284
Quantity:
MCE Japan Authorized Agent: