1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. CSF & Receptors Cytokine Receptors
  4. M-CSF R
  5. CSF1R Protein, Human (271a.a, HEK293, His)

CSF1R protein is ubiquitously found in mononuclear phagocytes, especially macrophages and monocytes, and is involved in a variety of biological processes. It induces the release of proinflammatory chemokines in response to IL34 and CSF1, contributing to innate immunity and inflammation. CSF1R Protein, Human (271a.a, HEK293, His) is the recombinant human-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CSF1R protein is ubiquitously found in mononuclear phagocytes, especially macrophages and monocytes, and is involved in a variety of biological processes. It induces the release of proinflammatory chemokines in response to IL34 and CSF1, contributing to innate immunity and inflammation. CSF1R Protein, Human (271a.a, HEK293, His) is the recombinant human-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.

Background

The CSF1R protein, particularly found in mononuclear phagocytes like macrophages and monocytes, is involved in various biological processes. It promotes the release of pro-inflammatory chemokines in response to IL34 and CSF1, contributing to innate immunity and inflammatory processes. Additionally, CSF1R is crucial for regulating osteoclast proliferation and differentiation, bone resorption, normal bone and tooth development. It is also required for normal fertility in both males and females, as well as for the development of milk ducts and acinar structures in the mammary gland during pregnancy.

Species

Human

Source

HEK293

Tag

C-His

Accession

P07333-1 (I20-S290)

Gene ID
Molecular Construction
N-term
CSF1R (I20-S290)
Accession # P07333-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Macrophage colony-stimulating factor 1 receptor; CSF-1R; M-CSF-R; CD115; CSF1R; FMS
AA Sequence

IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTS

Predicted Molecular Mass
31.1 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CSF1R Protein, Human (271a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CSF1R Protein, Human (271a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CSF1R Protein, Human (271a.a, HEK293, His)
Cat. No.:
HY-P75326
Quantity:
MCE Japan Authorized Agent: