CSF1R Protein, Human (271a.a, HEK293, His)

CSF1R protein is ubiquitously found in mononuclear phagocytes, especially macrophages and monocytes, and is involved in a variety of biological processes. It induces the release of proinflammatory chemokines in response to IL34 and CSF1, contributing to innate immunity and inflammation. CSF1R Protein, Human (271a.a, HEK293, His) is the recombinant human-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CSF1R protein is ubiquitously found in mononuclear phagocytes, especially macrophages and monocytes, and is involved in a variety of biological processes. It induces the release of proinflammatory chemokines in response to IL34 and CSF1, contributing to innate immunity and inflammation. CSF1R Protein, Human (271a.a, HEK293, His) is the recombinant human-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.

Background

The CSF1R protein, particularly found in mononuclear phagocytes like macrophages and monocytes, is involved in various biological processes. It promotes the release of pro-inflammatory chemokines in response to IL34 and CSF1, contributing to innate immunity and inflammatory processes. Additionally, CSF1R is crucial for regulating osteoclast proliferation and differentiation, bone resorption, normal bone and tooth development. It is also required for normal fertility in both males and females, as well as for the development of milk ducts and acinar structures in the mammary gland during pregnancy.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CSF1R (I20-S290)
      Accession # P07333-1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CSF1R; CSF-1R; Prev. FMS; Macrophage Colony Stimulating Factor I Receptor; C-FMS; Colony Stimulating Factor Receptor; CD115; Receptor Protein-Tyrosine Kinase; CSFR; FMS Proto-Oncogene; McDonough Feline Sarcoma Viral (V-Fms) Oncogene Homolog; BANDDOS; Macr

  • AA Sequence

    IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTS

  • Predicted Molecular Mass

    31.1 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00