CSF1R Protein, Human (271a.a, HEK293, His)
CSF1R protein is ubiquitously found in mononuclear phagocytes, especially macrophages and monocytes, and is involved in a variety of biological processes. It induces the release of proinflammatory chemokines in response to IL34 and CSF1, contributing to innate immunity and inflammation. CSF1R Protein, Human (271a.a, HEK293, His) is the recombinant human-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CSF1R protein is ubiquitously found in mononuclear phagocytes, especially macrophages and monocytes, and is involved in a variety of biological processes. It induces the release of proinflammatory chemokines in response to IL34 and CSF1, contributing to innate immunity and inflammation. CSF1R Protein, Human (271a.a, HEK293, His) is the recombinant human-derived CSF1R protein, expressed by HEK293 , with C-His labeled tag.
Background
The CSF1R protein, particularly found in mononuclear phagocytes like macrophages and monocytes, is involved in various biological processes. It promotes the release of pro-inflammatory chemokines in response to IL34 and CSF1, contributing to innate immunity and inflammatory processes. Additionally, CSF1R is crucial for regulating osteoclast proliferation and differentiation, bone resorption, normal bone and tooth development. It is also required for normal fertility in both males and females, as well as for the development of milk ducts and acinar structures in the mammary gland during pregnancy.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P07333-1 (I20-S290)
-
Molecular Construction
-
N-term
-
CSF1R (I20-S290)
Accession # P07333-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CSF1R; CSF-1R; Prev. FMS; Macrophage Colony Stimulating Factor I Receptor; C-FMS; Colony Stimulating Factor Receptor; CD115; Receptor Protein-Tyrosine Kinase; CSFR; FMS Proto-Oncogene; McDonough Feline Sarcoma Viral (V-Fms) Oncogene Homolog; BANDDOS; Macr
-
AA Sequence
IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTS
-
Predicted Molecular Mass
31.1 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)