CXCL14/BRAK Protein, Human (His)
Based on 1 Customer Validation
CXCL14/BRAK Protein, Human (His) is the recombinant human-derived CXCL14/BRAK protein, expressed by E. coli, with N-His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CXCL14/BRAK Protein, Human (His) is the recombinant human-derived CXCL14/BRAK protein, expressed by E. coli, with N-His tag.
Background
CXCL14/BRAK belongs to the cytokine gene family which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL14/BRAK encoded the protein which is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. CXCL14/BRAK displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. CXCL14/BRAK is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation[1][2][3][4][5].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O95715 (S35-E111)
-
Gene ID9547
-
Molecular Construction
-
N-term
-
His
-
CXCL14 (S35-E111)
Accession # O95715 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL14; Kec; Prev. SCYB14; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 14 (BRAK); NJAC; Chemokine (C-X-C Motif) Ligand 14; Small-Inducible Cytokine B14; Breast And Kidney; C-X-C Motif Chemokine 14; MIP-2G; Chemokine BRAK; MIP2G; Bolekine; CXC
-
AA Sequence
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
-
Predicted Molecular Mass
11.4 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution of PBS, 0.5M NaCl, 0.5 M Arginine, pH7.4 with 10% trehalose as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
