BCA-1/CXCL13 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The BCA-1/CXCL13 protein selectively attracts B lymphocytes without affecting T lymphocytes, monocytes, or neutrophils. Unlike other chemokines, it does not induce calcium release from B lymphocytes. BCA-1/CXCL13 Protein, Human (His) is the recombinant human-derived BCA-1/CXCL13 protein, expressed by E. coli, with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The BCA-1/CXCL13 protein selectively attracts B lymphocytes without affecting T lymphocytes, monocytes, or neutrophils. Unlike other chemokines, it does not induce calcium release from B lymphocytes. BCA-1/CXCL13 Protein, Human (His) is the recombinant human-derived BCA-1/CXCL13 protein, expressed by E. coli, with N-His labeled tag.

Background

The BCA-1/CXCL13 protein acts as a selective chemotactic factor for B-lymphocytes, distinguishing its effects from T-lymphocytes, monocytes, and neutrophils. Unlike other chemokines, it does not induce calcium release in B-lymphocytes. Its specificity for B-lymphocytes is evidenced by its binding to BLR1/CXCR5, emphasizing its role in orchestrating B-cell migration. This selectivity in chemotactic function and receptor binding positions BCA-1/CXCL13 as a key regulator in the immune system, contributing to the precise recruitment and activation of B-lymphocytes within the cellular microenvironment.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CXL13 (V23-P109)
      Accession # O43927-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CXCL13; C-X-C Motif Chemokine 13; Prev. SCYB13; CXC Chemokine BLC; BCA-1; BCA1; BLC; B-Cell-Homing Chemokine (Ligand For Burkitt'S Lymphoma Receptor-1); ANGIE2; Chemokine (C-X-C Motif) Ligand 13 (B-Cell Chemoattractant); BLR1L; Chemokine (C-X-C Motif) Lig

  • AA Sequence

    VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

  • Predicted Molecular Mass

    12.3 kDa

  • Molecular Weight

    Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00