BCA-1/CXCL13 Protein, Human (His)
Based on 1 Customer Validation
The BCA-1/CXCL13 protein selectively attracts B lymphocytes without affecting T lymphocytes, monocytes, or neutrophils. Unlike other chemokines, it does not induce calcium release from B lymphocytes. BCA-1/CXCL13 Protein, Human (His) is the recombinant human-derived BCA-1/CXCL13 protein, expressed by E. coli, with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The BCA-1/CXCL13 protein selectively attracts B lymphocytes without affecting T lymphocytes, monocytes, or neutrophils. Unlike other chemokines, it does not induce calcium release from B lymphocytes. BCA-1/CXCL13 Protein, Human (His) is the recombinant human-derived BCA-1/CXCL13 protein, expressed by E. coli, with N-His labeled tag.
Background
The BCA-1/CXCL13 protein acts as a selective chemotactic factor for B-lymphocytes, distinguishing its effects from T-lymphocytes, monocytes, and neutrophils. Unlike other chemokines, it does not induce calcium release in B-lymphocytes. Its specificity for B-lymphocytes is evidenced by its binding to BLR1/CXCR5, emphasizing its role in orchestrating B-cell migration. This selectivity in chemotactic function and receptor binding positions BCA-1/CXCL13 as a key regulator in the immune system, contributing to the precise recruitment and activation of B-lymphocytes within the cellular microenvironment.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O43927-1 (V23-P109)
-
Gene ID10563
-
Molecular Construction
-
N-term
-
His
-
CXL13 (V23-P109)
Accession # O43927-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CXCL13; C-X-C Motif Chemokine 13; Prev. SCYB13; CXC Chemokine BLC; BCA-1; BCA1; BLC; B-Cell-Homing Chemokine (Ligand For Burkitt'S Lymphoma Receptor-1); ANGIE2; Chemokine (C-X-C Motif) Ligand 13 (B-Cell Chemoattractant); BLR1L; Chemokine (C-X-C Motif) Lig
-
AA Sequence
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
-
Predicted Molecular Mass
12.3 kDa
-
Molecular Weight
Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
