Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

Dectin-1/CLEC7A protein has (1->3)-β-D-glucan binding and pattern recognition receptor activity, participates in immune responses and recognizes specific structures. It regulates cytokine production and responds to fungal pathogens while being active on the cell surface. Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Dectin-1/CLEC7A protein has (1->3)-β-D-glucan binding and pattern recognition receptor activity, participates in immune responses and recognizes specific structures. It regulates cytokine production and responds to fungal pathogens while being active on the cell surface. Dectin-1/CLEC7A Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-His labeled tag.

Background

The Dectin-1/CLEC7A protein is predicted to possess (1->3)-beta-D-glucan binding activity and pattern recognition receptor activity, making it capable of recognizing specific structures and participating in immune responses. It is also predicted to play a role in various processes, such as phagocytosis and recognition, as well as positively regulating the production of cytokines involved in inflammatory responses and responding to fungal pathogens. Functionally, it is known to be active on the cell surface. The protein is expressed in multiple tissues, including the brain, gut, limb, musculature, and ventral grey horn. In humans, mutations in the orthologous gene CLEC7A have been implicated in aspergillosis and chronic mucocutaneous candidiasis, suggesting its importance in immune defense against these conditions (Alliance of Genome Resources.April 2022). Moreover, the Dectin-1/CLEC7A protein shows broad expression across various tissues, including the lung (RPKM 2.7), bladder (RPKM 1.9), and 16 other tissues.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CLEC7A (F69-L244)
      Accession # NP_064392.2
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC7A; CDNA FLJ59887, Moderately Similar To Homo Sapiens C-Type Lectin Domain Family 7, Member A (CLEC7A), Transcript Variant 4, MRNA; Prev. CLECSF12; C-Type Lectin Domain Containing 7A Transcript Variant 7; C-Type Lectin Domain Family 7 Member A; C-Type

  • AA Sequence

    FWRHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL

  • Predicted Molecular Mass

    22.5 kDa

  • Molecular Weight

    Approximately 30-37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00