1. Recombinant Proteins
  2. CD Antigens
  3. B Cell CD Proteins Macrophage CD Proteins Platelet CD Proteins Epithelial cell CD Proteins
  4. DEP-1/CD148
  5. DEP-1/CD148 Protein, Human (341a.a, His)

DEP-1/CD148 protein is a tyrosine phosphatase that affects multiple targets such as CTNND1, FLT3, PDGFRB, and EGFR, thereby affecting cellular processes such as adhesion, migration, proliferation, and differentiation. DEP-1/CD148 is critical in vascular development, regulating macrophage adhesion, platelet activation, and thrombosis, while negatively regulating cell proliferation and PDGF-stimulated migration. DEP-1/CD148 Protein, Human (341a.a, His) is the recombinant human-derived DEP-1/CD148 protein, expressed by E. coli , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

DEP-1/CD148 protein is a tyrosine phosphatase that affects multiple targets such as CTNND1, FLT3, PDGFRB, and EGFR, thereby affecting cellular processes such as adhesion, migration, proliferation, and differentiation. DEP-1/CD148 is critical in vascular development, regulating macrophage adhesion, platelet activation, and thrombosis, while negatively regulating cell proliferation and PDGF-stimulated migration. DEP-1/CD148 Protein, Human (341a.a, His) is the recombinant human-derived DEP-1/CD148 protein, expressed by E. coli , with N-His labeled tag.

Background

DEP-1/CD148 protein, a tyrosine phosphatase, exerts its influence on a wide array of molecular targets, including CTNND1, FLT3, PDGFRB, MET, KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1, and PIK3R2. Its involvement extends to various cellular processes such as adhesion, migration, proliferation, and differentiation. In vascular development, DEP-1/CD148 plays a crucial role, serving as a regulator of macrophage adhesion and spreading while positively influencing cell-matrix adhesion. Moreover, it acts as a positive regulator of platelet activation and thrombosis while concurrently functioning as a negative regulator of cell proliferation and PDGF-stimulated cell migration through the dephosphorylation of PDGFR. DEP-1/CD148 also positively regulates endothelial cell survival and VEGF-induced SRC and AKT activation by dephosphorylating KDR. It negatively regulates the EGFR signaling pathway and enhances the barrier function of epithelial junctions during reassembly. In T-cell receptor (TCR) signaling, DEP-1/CD148 serves as a negative regulator, being up-regulated upon TCR activation and excluded from immunological synapses, subsequently dephosphorylating PLCG1 and LAT to down-regulate signaling prolongation upon T-cell-antigen presenting cells (APC) disengagement. Additionally, it activates angiogenesis and cell migration while downregulating the expression of endothelial adhesion molecules ICAM1 and VCAM1. The multifaceted activities of DEP-1/CD148 underscore its pivotal role in governing diverse cellular processes and signaling pathways.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q12913-1 (R997-A1337)

Gene ID
Molecular Construction
N-term
His
DEP-1 (R997-A1337)
Accession # Q12913-1
C-term
Protein Length

Cytoplasmic Domain

Synonyms
Receptor-type tyrosine-protein phosphatase eta; R-PTP-eta; DEP-1; CD148; PTPRJ
AA Sequence

RKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA

Peso molecular

Approximately 37 kDa

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

DEP-1/CD148 Protein, Human (341a.a, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
DEP-1/CD148 Protein, Human (341a.a, His)
Cat. No.:
HY-P74200
Cantidad:
MCE Japan Authorized Agent: