DEP-1/CD148 Protein, Human (341a.a, His)
Based on 1 Customer Validation
DEP-1/CD148 protein is a tyrosine phosphatase that affects multiple targets such as CTNND1, FLT3, PDGFRB, and EGFR, thereby affecting cellular processes such as adhesion, migration, proliferation, and differentiation. DEP-1/CD148 is critical in vascular development, regulating macrophage adhesion, platelet activation, and thrombosis, while negatively regulating cell proliferation and PDGF-stimulated migration. DEP-1/CD148 Protein, Human (341a.a, His) is the recombinant human-derived DEP-1/CD148 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
DEP-1/CD148 protein is a tyrosine phosphatase that affects multiple targets such as CTNND1, FLT3, PDGFRB, and EGFR, thereby affecting cellular processes such as adhesion, migration, proliferation, and differentiation. DEP-1/CD148 is critical in vascular development, regulating macrophage adhesion, platelet activation, and thrombosis, while negatively regulating cell proliferation and PDGF-stimulated migration. DEP-1/CD148 Protein, Human (341a.a, His) is the recombinant human-derived DEP-1/CD148 protein, expressed by E. coli , with N-His labeled tag.
Background
DEP-1/CD148 protein, a tyrosine phosphatase, exerts its influence on a wide array of molecular targets, including CTNND1, FLT3, PDGFRB, MET, KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1, and PIK3R2. Its involvement extends to various cellular processes such as adhesion, migration, proliferation, and differentiation. In vascular development, DEP-1/CD148 plays a crucial role, serving as a regulator of macrophage adhesion and spreading while positively influencing cell-matrix adhesion. Moreover, it acts as a positive regulator of platelet activation and thrombosis while concurrently functioning as a negative regulator of cell proliferation and PDGF-stimulated cell migration through the dephosphorylation of PDGFR. DEP-1/CD148 also positively regulates endothelial cell survival and VEGF-induced SRC and AKT activation by dephosphorylating KDR. It negatively regulates the EGFR signaling pathway and enhances the barrier function of epithelial junctions during reassembly. In T-cell receptor (TCR) signaling, DEP-1/CD148 serves as a negative regulator, being up-regulated upon TCR activation and excluded from immunological synapses, subsequently dephosphorylating PLCG1 and LAT to down-regulate signaling prolongation upon T-cell-antigen presenting cells (APC) disengagement. Additionally, it activates angiogenesis and cell migration while downregulating the expression of endothelial adhesion molecules ICAM1 and VCAM1. The multifaceted activities of DEP-1/CD148 underscore its pivotal role in governing diverse cellular processes and signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q12913-1 (R997-A1337)
-
Molecular Construction
-
N-term
-
His
-
DEP-1 (R997-A1337)
Accession # Q12913-1 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
PTPRJ; HPTP Eta; Protein Tyrosine Phosphatase Receptor Type J; R-PTP-J; DEP1; Protein Tyrosine Phosphatase, Receptor Type, J Polypeptide; Receptor-Type Tyrosine-Protein Phosphatase Eta; Susceptibility To Colon Cancer 1, Mouse, Homolog Of; HPTPeta; Human D
-
AA Sequence
RKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA
-
Predicted Molecular Mass
41 kDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)