DEP-1/CD148 Protein, Human (341a.a, His)

Customer Review

Based on 1 Customer Validation

DEP-1/CD148 protein is a tyrosine phosphatase that affects multiple targets such as CTNND1, FLT3, PDGFRB, and EGFR, thereby affecting cellular processes such as adhesion, migration, proliferation, and differentiation. DEP-1/CD148 is critical in vascular development, regulating macrophage adhesion, platelet activation, and thrombosis, while negatively regulating cell proliferation and PDGF-stimulated migration. DEP-1/CD148 Protein, Human (341a.a, His) is the recombinant human-derived DEP-1/CD148 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

DEP-1/CD148 protein is a tyrosine phosphatase that affects multiple targets such as CTNND1, FLT3, PDGFRB, and EGFR, thereby affecting cellular processes such as adhesion, migration, proliferation, and differentiation. DEP-1/CD148 is critical in vascular development, regulating macrophage adhesion, platelet activation, and thrombosis, while negatively regulating cell proliferation and PDGF-stimulated migration. DEP-1/CD148 Protein, Human (341a.a, His) is the recombinant human-derived DEP-1/CD148 protein, expressed by E. coli , with N-His labeled tag.

Background

DEP-1/CD148 protein, a tyrosine phosphatase, exerts its influence on a wide array of molecular targets, including CTNND1, FLT3, PDGFRB, MET, KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1, and PIK3R2. Its involvement extends to various cellular processes such as adhesion, migration, proliferation, and differentiation. In vascular development, DEP-1/CD148 plays a crucial role, serving as a regulator of macrophage adhesion and spreading while positively influencing cell-matrix adhesion. Moreover, it acts as a positive regulator of platelet activation and thrombosis while concurrently functioning as a negative regulator of cell proliferation and PDGF-stimulated cell migration through the dephosphorylation of PDGFR. DEP-1/CD148 also positively regulates endothelial cell survival and VEGF-induced SRC and AKT activation by dephosphorylating KDR. It negatively regulates the EGFR signaling pathway and enhances the barrier function of epithelial junctions during reassembly. In T-cell receptor (TCR) signaling, DEP-1/CD148 serves as a negative regulator, being up-regulated upon TCR activation and excluded from immunological synapses, subsequently dephosphorylating PLCG1 and LAT to down-regulate signaling prolongation upon T-cell-antigen presenting cells (APC) disengagement. Additionally, it activates angiogenesis and cell migration while downregulating the expression of endothelial adhesion molecules ICAM1 and VCAM1. The multifaceted activities of DEP-1/CD148 underscore its pivotal role in governing diverse cellular processes and signaling pathways.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • DEP-1 (R997-A1337)
      Accession # Q12913-1
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    PTPRJ; HPTP Eta; Protein Tyrosine Phosphatase Receptor Type J; R-PTP-J; DEP1; Protein Tyrosine Phosphatase, Receptor Type, J Polypeptide; Receptor-Type Tyrosine-Protein Phosphatase Eta; Susceptibility To Colon Cancer 1, Mouse, Homolog Of; HPTPeta; Human D

  • AA Sequence

    RKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA

  • Predicted Molecular Mass

    41 kDa

  • Molecular Weight

    Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00