Desmin/DES Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Desmin is a muscle-specific type III intermediate filament that is critical for muscle structural integrity. It forms myofibrils, interconnects Z-disks and strengthens muscle fibers. Desmin/DES Protein, Human (His) is the recombinant human-derived Desmin/DES protein, expressed by E. coli , with N-6*His labeled tag.

Background

Desmin, a muscle-specific type III intermediate filament, is indispensable for maintaining the structural integrity and optimal function of muscles. It plays a crucial role in forming myofibrils and interconnecting Z-disks, providing strength to muscle fibers during activity. In adult striated muscle, Desmin contributes to the fibrous network that links myofibrils to each other and to the plasma membrane at the periphery of Z-line structures. Additionally, Desmin may serve as a sarcomeric microtubule-anchoring protein by associating with detyrosinated tubulin-alpha chains, resulting in buckled microtubules and increased mechanical resistance to contraction. Beyond its structural functions, Desmin participates in the transcriptional regulation of the NKX2-5 gene during cardiomyogenesis and in cardiac side population stem cells. Moreover, it plays a role in maintaining the optimal conformation of nebulette on heart muscle sarcomeres, facilitating the binding and recruitment of cardiac alpha-actin. Desmin engages in various interactions with proteins such as DST, MTM1, EPPK1, CRYAB, NEB, NEBL, ASB2, PLEC, and PKP1, highlighting its multifaceted involvement in molecular networks essential for muscle physiology.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • Desmin (V261-L470)
      Accession # P17661
    • C-term
  • Protein Length

    Partial

  • Synonyms

    DES; CMD1I; Desmin; Cardiomyopathy, Dilated 1F (Autosomal Dominant); LGMD2R; Epididymis Secretory Sperm Binding Protein; CSM1; LGMD1D; CSM2; LGMD1E; Intermediate Filament Protein; CDCD3; Cardiomyopathy, Dilated 1I

  • AA Sequence

    VEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

  • Predicted Molecular Mass

    26.7 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00