DLG4 Protein, Human (Biotinylated, Avi)

DLG4 Protein, Human (Biotinylated, Avi) is the recombinant human-derived DLG4, expressed by E. coli , with Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

DLG4 Protein, Human (Biotinylated, Avi) is the recombinant human-derived DLG4, expressed by E. coli , with Avi labeled tag.

Background

DLG4 is a postsynaptic scaffolding protein that plays a critical role in synaptogenesis and synaptic plasticity by providing a platform for the postsynaptic clustering of crucial synaptic proteins. It interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels and is required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 alters the ratio of excitatory to inhibitory synapses in hippocampal neurons. It may reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly and may regulate the intracellular trafficking of ADR1B. Additionally, DLG4 regulates AMPA-type glutamate receptor (AMPAR) immobilization at the postsynaptic density, maintaining the channels in an activated state in the presence of glutamate and preventing synaptic depression (by similar). Under basal conditions, DLG4 cooperates with FYN to stabilize palmitoyltransferase ZDHHC5 at the synaptic membrane through FYN-mediated phosphorylation of ZDHHC5 and subsequent inhibition of its association with endocytic proteins.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-Avi
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-2

  • Conjugation

    Biotin

  • Synonyms

    DLG4; Postsynaptic Density Protein 95; Discs Large MAGUK Scaffold Protein 4; Tax Interaction Protein 15; SAP-90; Discs Large Homolog 4; PSD95; Discs, Large Homolog 4 (Drosophila), Isoform CRA_d; SAP90; Discs, Large Homolog 4 (Drosophila); Synapse-Associat

  • AA Sequence

    REPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTAS

  • Predicted Molecular Mass

    14.3 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00