DLG4 Protein, Human (Biotinylated, Avi)
DLG4 Protein, Human (Biotinylated, Avi) is the recombinant human-derived DLG4, expressed by E. coli , with Avi labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
DLG4 Protein, Human (Biotinylated, Avi) is the recombinant human-derived DLG4, expressed by E. coli , with Avi labeled tag.
Background
DLG4 is a postsynaptic scaffolding protein that plays a critical role in synaptogenesis and synaptic plasticity by providing a platform for the postsynaptic clustering of crucial synaptic proteins. It interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels and is required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 alters the ratio of excitatory to inhibitory synapses in hippocampal neurons. It may reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly and may regulate the intracellular trafficking of ADR1B. Additionally, DLG4 regulates AMPA-type glutamate receptor (AMPAR) immobilization at the postsynaptic density, maintaining the channels in an activated state in the presence of glutamate and preventing synaptic depression (by similar). Under basal conditions, DLG4 cooperates with FYN to stabilize palmitoyltransferase ZDHHC5 at the synaptic membrane through FYN-mediated phosphorylation of ZDHHC5 and subsequent inhibition of its association with endocytic proteins.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Avi
-
Accession
P78352-1 (R309-S422)
-
Gene ID1742
-
Protein Length
Full Length of Isoform-2
-
Conjugation
Biotin
-
Synonyms
DLG4; Postsynaptic Density Protein 95; Discs Large MAGUK Scaffold Protein 4; Tax Interaction Protein 15; SAP-90; Discs Large Homolog 4; PSD95; Discs, Large Homolog 4 (Drosophila), Isoform CRA_d; SAP90; Discs, Large Homolog 4 (Drosophila); Synapse-Associat
-
AA Sequence
REPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTAS
-
Predicted Molecular Mass
14.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)