Delta-like protein 3/DLL3 Protein, Human (HEK293, His)

Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (HEK293, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Delta-like protein 3/DLL3 emerges as a key regulator in the intricate landscape of neurogenesis and cellular differentiation. Acting as an inhibitor of primary neurogenesis, DLL3 is believed to play a crucial role in steering neurons along specific differentiation pathways. Its involvement extends beyond neurogenesis, contributing to the formation of somite boundaries during the segmentation of the paraxial mesoderm. Notably, DLL3 exhibits the capability to bind and activate Notch-1 or other Notch receptors, underscoring its significance in orchestrating cellular processes that govern developmental pathways and cellular fate determination.

1.Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 μg/mL can bind Anti-DLL3 Recombinant Antibody, the EC₅₀ is 1-15 ng/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human DLL3 at 1 µg/mL(100 µL/well) can bind Anti-DLL3 Antibody. The ED₅₀ for this effect is 1-3 ng/mL.
3. Loaded Gocatamig (HY-P990920) on AHC2 biosensor, can bind Delta-like protein 3/DLL3 Protein, Human (HEK293, His) with an affinity constant of 4.341E-09 M as determined in BLI assay.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human DLL3 at 1 µg/mL(100 µL/well) can bind Anti-DLL3 Antibody. The ED₅₀ for this effect is 1.854 ng/mL.
• 
  Loaded Gocatamig (HY-P990920) on AHC2 biosensor, can bind Delta-like protein 3/DLL3 Protein, Human (HEK293, His) with an affinity constant of 4.341E-09 M as determined in BLI assay.

Human

HEK293

C-6*His

Q9NYJ7-1 (A27-L492)

10683  [NCBI]

Extracellular Domain

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Approximately 52-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 200 mM arginine, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.