Copy Link Print Information

DLST Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

The DLST protein is part of the 2-oxoglutarate dehydrogenase complex, which converts 2-oxoglutarate into succinyl-CoA and CO(2). It is active in the mitochondrion and plays a role in histone succinylation in the nucleus by supplying succinyl-CoA to the histone succinyltransferase KAT2A. DLST Protein, Human (sf9, His) is the recombinant human-derived DLST protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • DLST Protein, Human (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The DLST protein is part of the 2-oxoglutarate dehydrogenase complex, which converts 2-oxoglutarate into succinyl-CoA and CO(2). It is active in the mitochondrion and plays a role in histone succinylation in the nucleus by supplying succinyl-CoA to the histone succinyltransferase KAT2A. DLST Protein, Human (sf9, His) is the recombinant human-derived DLST protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

DLST protein functions as the dihydrolipoamide succinyltransferase (E2) component within the 2-oxoglutarate dehydrogenase complex, a key player in cellular metabolism. This complex catalyzes the conversion of 2-oxoglutarate to succinyl-CoA and CO(2), predominantly operating in the mitochondrion. Notably, a fraction of the 2-oxoglutarate dehydrogenase complex localizes in the nucleus, where DLST is crucial for lysine succinylation of histones. DLST associates with KAT2A on chromatin, providing succinyl-CoA to histone succinyltransferase KAT2A. This dual localization underscores DLST's pivotal role in coordinating metabolic processes within the mitochondria and contributing to epigenetic modifications in the nucleus, highlighting its multifaceted functionality in cellular homeostasis.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His
  • Accession

    P36957 (D68-L453)

  • Gene ID
    1743  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • DLST (D68-L453)
      Accession # P36957
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    DLST; Dihydrolipoamide Succinyltransferase Component Of 2-Oxoglutarate Dehydrogenase Complex; Prev. DLTS; CDNA, FLJ79362, Moderately Similar To Dihydrolipoyllysine-Residue Succinyltransferase Component Of 2- Oxoglutarate Dehydrogenase Complex, Mitochondri

  • AA Sequence

    DDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

  • Predicted Molecular Mass

    43.9 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, pH 7.5, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • DLST Protein, Human (sf9, His) Product Image
    1/16
  • DLST Protein, Human (sf9, His) Product Image