DLST Protein, Human (sf9, His)

The DLST protein is part of the 2-oxoglutarate dehydrogenase complex, which converts 2-oxoglutarate into succinyl-CoA and CO(2). It is active in the mitochondrion and plays a role in histone succinylation in the nucleus by supplying succinyl-CoA to the histone succinyltransferase KAT2A. DLST Protein, Human (sf9, His) is the recombinant human-derived DLST protein, expressed by Sf9 insect cells , with N-His labeled tag.

DLST protein functions as the dihydrolipoamide succinyltransferase (E2) component within the 2-oxoglutarate dehydrogenase complex, a key player in cellular metabolism. This complex catalyzes the conversion of 2-oxoglutarate to succinyl-CoA and CO(2), predominantly operating in the mitochondrion. Notably, a fraction of the 2-oxoglutarate dehydrogenase complex localizes in the nucleus, where DLST is crucial for lysine succinylation of histones. DLST associates with KAT2A on chromatin, providing succinyl-CoA to histone succinyltransferase KAT2A. This dual localization underscores DLST's pivotal role in coordinating metabolic processes within the mitochondria and contributing to epigenetic modifications in the nucleus, highlighting its multifaceted functionality in cellular homeostasis.

Human

Sf9 insect cells

N-His

P36957 (D68-L453)

1743  [NCBI]

Full Length of Mature Protein

DDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

Approximately 43.9 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, pH 7.5, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.