1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. DLST Protein, Human (sf9, His)

The DLST protein is part of the 2-oxoglutarate dehydrogenase complex, which converts 2-oxoglutarate into succinyl-CoA and CO(2). It is active in the mitochondrion and plays a role in histone succinylation in the nucleus by supplying succinyl-CoA to the histone succinyltransferase KAT2A. DLST Protein, Human (sf9, His) is the recombinant human-derived DLST protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DLST protein is part of the 2-oxoglutarate dehydrogenase complex, which converts 2-oxoglutarate into succinyl-CoA and CO(2). It is active in the mitochondrion and plays a role in histone succinylation in the nucleus by supplying succinyl-CoA to the histone succinyltransferase KAT2A. DLST Protein, Human (sf9, His) is the recombinant human-derived DLST protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

DLST protein functions as the dihydrolipoamide succinyltransferase (E2) component within the 2-oxoglutarate dehydrogenase complex, a key player in cellular metabolism. This complex catalyzes the conversion of 2-oxoglutarate to succinyl-CoA and CO(2), predominantly operating in the mitochondrion. Notably, a fraction of the 2-oxoglutarate dehydrogenase complex localizes in the nucleus, where DLST is crucial for lysine succinylation of histones. DLST associates with KAT2A on chromatin, providing succinyl-CoA to histone succinyltransferase KAT2A. This dual localization underscores DLST's pivotal role in coordinating metabolic processes within the mitochondria and contributing to epigenetic modifications in the nucleus, highlighting its multifaceted functionality in cellular homeostasis.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

P36957 (D68-L453)

Gene ID
Molecular Construction
N-term
His
DLST (D68-L453)
Accession # P36957
C-term
Protein Length

Full Length of Mature Protein

Synonyms
2-oxoglutarate dehydrogenase complex component E2; OGDC-E2; E2K; DLST; DLTS
AA Sequence

DDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

Molecular Weight

Approximately 43.9 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, pH 7.5, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

DLST Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DLST Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DLST Protein, Human (sf9, His)
Cat. No.:
HY-P75709
Quantity:
MCE Japan Authorized Agent: