DNAM-1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
DNAM-1 Protein, a cell surface receptor, mediates intercellular adhesion, signaling, cytotoxicity, and lymphokine secretion in CTL and NK cells. It acts as a receptor for NECTIN2, stimulating T-cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG). DNAM-1 Protein competes with PVRIG for NECTIN2-binding and interacts with PVR and NECTIN2. DNAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DNAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DNAM-1 Protein, a cell surface receptor, mediates intercellular adhesion, signaling, cytotoxicity, and lymphokine secretion in CTL and NK cells. It acts as a receptor for NECTIN2, stimulating T-cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG). DNAM-1 Protein competes with PVRIG for NECTIN2-binding and interacts with PVR and NECTIN2. DNAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DNAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
DNAM-1 Protein, a cell surface receptor, is involved in intercellular adhesion, lymphocyte signaling, cytotoxicity, and lymphokine secretion mediated by cytotoxic T-lymphocytes (CTL) and natural killer (NK) cells. It acts as a receptor for NECTIN2 and, upon ligand binding, stimulates T-cell proliferation and cytokine production, including IL2, IL5, IL10, IL13, and IFNG. DNAM-1 Protein competes with PVRIG for NECTIN2-binding and interacts with PVR and NECTIN2.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8K4F0 (E19-P254)
-
Molecular Construction
-
N-term
-
DNAM-1 (E19-P254)
Accession # Q8K4F0 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD226; PTA1; CD226 Molecule; T Lineage-Specific Activation Antigen 1 Antigen; CD226 Antigen; Platelet And T Cell Activation Antigen 1; DNAM-1; DNAX Accessory Molecule-1; DNAM1; DNAX Accessory Molecule 1; TLiSA1; Adhesion Glycoprotein
-
AA Sequence
EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
-
Predicted Molecular Mass
27.6 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
