DPEP2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The DPEP2 protein functions as a dipeptidase capable of hydrolyzing leukotriene D4 (LTD4) into leukotriene E4 (LTE4) and cysteinyl diglycine. In addition to its dipeptidase activity, DPEP2 serves as a modulator of macrophage inflammatory responses by acting as a modulator of the NF-kappaB inflammatory signaling pathway. DPEP2 Protein, Human (HEK293, His) is the recombinant human-derived DPEP2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The DPEP2 protein functions as a dipeptidase capable of hydrolyzing leukotriene D4 (LTD4) into leukotriene E4 (LTE4) and cysteinyl diglycine. In addition to its dipeptidase activity, DPEP2 serves as a modulator of macrophage inflammatory responses by acting as a modulator of the NF-kappaB inflammatory signaling pathway. DPEP2 Protein, Human (HEK293, His) is the recombinant human-derived DPEP2 protein, expressed by HEK293 , with C-His labeled tag.

Background

DPEP2 (Dipeptidase 2) is a versatile protein with dipeptidase activity, exhibiting the ability to hydrolyze leukotriene D4 (LTD4) into leukotriene E4 (LTE4), as well as cleave cystinyl-bis-glycine. Beyond its enzymatic functions, DPEP2 possesses an independent role in modulating macrophage inflammatory responses by acting as a regulator of the NF-kappaB inflammatory signaling pathway. This dual functionality suggests that DPEP2 plays a multifaceted role in cellular processes, participating both in the metabolism of bioactive lipids and in the regulation of key inflammatory pathways, showcasing its importance in immune and inflammatory responses.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • DPEP2 (A33-S376)
      Accession # Q9H4A9-2
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    DPEP2; Dipeptidase; Dipeptidase 2; MBD2

  • AA Sequence

    AYTTPGPPRAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVS

  • Molecular Weight

    Approximately 47 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00