DR3/TNFRSF25 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The DR3/TNFRSF25 protein displays defects in conserved residues critical for propagation feature annotation. This defect in DR3/TNFRSF25 prevents the propagation of specific functional features associated with this protein. DR3/TNFRSF25 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DR3/TNFRSF25 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The DR3/TNFRSF25 protein displays defects in conserved residues critical for propagation feature annotation. This defect in DR3/TNFRSF25 prevents the propagation of specific functional features associated with this protein. DR3/TNFRSF25 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DR3/TNFRSF25 protein, expressed by HEK293 , with C-His labeled tag.
Background
DR3/TNFRSF25 protein displays a deficiency in the conserved residue(s) that are essential for propagating feature annotation. This deficiency in DR3/TNFRSF25 hinders the propagation of specific functional characteristics associated with this protein. DR3, also known as TNFRSF25, is a member of the tumor necrosis factor receptor superfamily. It is primarily expressed on the surface of immune cells, including T cells and natural killer cells, and plays a crucial role in regulating immune responses. DR3 functions as a receptor for its ligand, TL1A, and upon binding, it activates various signaling pathways that contribute to immune cell activation, proliferation, and cytokine production. The impact of the deficient residue(s) in DR3/TNFRSF25 on its function and its role in immune regulation necessitates further investigation to uncover the implications of this deficiency on immune responses mediated by DR3.
Verified Bioactivity
1.Immobilized Mouse DR3, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Mouse TNFSF15, His Tag with the EC50 of ≤8.8 ng/mL determined by ELISA.
2.Mouse TNFSF15, hFc Tag captured on CM5 Chip via Protein A can bind Mouse DR3, His Tag with an affinity constant of 8.98 nM as determined in SPR assay (Biacore T200).
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
B1AWN9 (Q31-M196)
-
Molecular Construction
-
N-term
-
DR3 (Q31-M196)
Accession # B1AWN9 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TNFRSF25; Apoptosis-Mediating Receptor DR3; Prev. TNFRSF12; Protein WSL-1; LARD; Tumor Necrosis Factor Receptor Superfamily Member 25 Deletion Mutant; DDR3; Tumor Necrosis Factor Receptor Superfamily, Member 25; DR3; Death Domain Receptor 3 Soluble Form;
-
AA Sequence
QGGMSGRCDCASESQKRYGPFCCRGCPKGHYMKAPCAEPCGNSTCLPCPSDTFLTRDNHFKTDCTRCQVCDEEALQVTLENCSAKSDTHCGCQSGWCVDCSTEPCGKSSPFSCVPCGATTPVHEAPTPRPCLPGFYIRGNDCTSCPTGFSSVCPKACTAVCGWKQM
-
Predicted Molecular Mass
18.8 kDa
-
Molecular Weight
Approximately 38-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
