EDNRA Protein-VLP, Human (HEK293)
EDNRA Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EDNRA Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
Background
EDNRA, a pivotal player in cellular signaling, operates as a receptor for endothelin-1, executing its actions through G proteins and initiating a phosphatidylinositol-calcium second messenger system. This receptor exhibits varying binding affinities, with ET1 holding the highest affinity, followed by ET2 and ET3. Beyond its canonical functions in endothelin signaling, EDNRA engages in molecular interactions, forming complexes with HDAC7 and KAT5, potentially contributing to intricate cellular regulatory networks. The convergence of endothelin-1 signaling and protein interactions highlights the multifaceted role of EDNRA in orchestrating diverse cellular processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P25101 (D21-N427)
-
Gene ID1909
-
Molecular Construction
-
N-term
-
EDNRA (D21-N427)
Accession # P25101 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
EDNRA; ETA; Endothelin Receptor Type A; Endothelin-1-Specific Receptor; HET-AR; Endothelin Receptor Subtype A; ETA-R; G Protein-Coupled Receptor; ET-A; ETAR; Endothelin-1 Receptor; MFDA; ETRA
-
AA Sequence
DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
