EEF1E1 Protein, Human (His)
Based on 1 Customer Validation
The EEF1E1 protein is an important component of a multi-subunit complex that actively regulates the ATM response to DNA damage. It coordinates tRNA ligases of various amino acids and interacts with both MARS1 and EPRS1 in a core complex with AIMP2. EEF1E1 Protein, Human (His) is the recombinant human-derived EEF1E1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The EEF1E1 protein is an important component of a multi-subunit complex that actively regulates the ATM response to DNA damage. It coordinates tRNA ligases of various amino acids and interacts with both MARS1 and EPRS1 in a core complex with AIMP2. EEF1E1 Protein, Human (His) is the recombinant human-derived EEF1E1 protein, expressed by E. coli , with N-His labeled tag.
EEF1E1, a positive modulator of the ATM response to DNA damage, is a crucial component of a multisubunit complex that orchestrates tRNA ligases for Arg (RARS1), Asp (DARS1), Gln (QARS1), Ile (IARS1), Leu (LARS1), Lys (KARS1), Met (MARS1), and the bifunctional ligase for Glu and Pro (EPRS1), along with the auxiliary subunits AIMP1/p43, AIMP2/p38, and EEF1E1/p18. It forms a linear complex containing MARS1, EEF1E1, EPRS1, and AIMP2 at its core. EEF1E1 exhibits simultaneous interaction with MARS1 and EPRS1, highlighting its integral role in the multisubunit complex. Additionally, EEF1E1 interacts with ATM and ATR. The interaction with ATM, independent of TP53, is induced by DNA damage resulting from genotoxic stress or cell growth, while the interaction with ATR is heightened in response to UV irradiation. This intricate network underscores EEF1E1's significance in coordinating DNA damage response mechanisms.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O43324 (M1-H174)
-
Molecular Construction
-
N-term
-
His
-
EEF1E1 (M1-H174)
Accession # O43324 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EEF1E1; Multisynthase Complex Auxiliary Component P18; Prev. P18; Elongation Factor P18; AIMP3; P18 Component Of Aminoacyl-TRNA Synthetase Complex; Aminoacyl TRNA Synthetase Complex-Interacting Multifunctional Protein 3; ARS-Interacting Multifunctional Pr
-
AA Sequence
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
-
Molecular Weight
Approximately 19-24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
