EIF5 Protein, Human (His-SUMO)
The EIF5 protein is a key member of the 43S pre-initiation complex (43S PIC) and actively participates in mRNA cap-proximal binding, scanning 5'-untranslated regions and locating start codons. EIF5 Protein, Human (His-SUMO) is the recombinant human-derived EIF5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The EIF5 protein is a key member of the 43S pre-initiation complex (43S PIC) and actively participates in mRNA cap-proximal binding, scanning 5'-untranslated regions and locating start codons. EIF5 Protein, Human (His-SUMO) is the recombinant human-derived EIF5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
EIF5 serves as a crucial component of the 43S pre-initiation complex (43S PIC), participating in the initiation of protein synthesis. Within this complex, EIF5 plays a key role in mRNA scanning, start codon recognition, and GTP hydrolysis. Acting as a GTPase-activating protein, EIF5 promotes the hydrolysis of GTP by eIF2G (EIF2S3). During the scanning process, EIF5 interacts with both EIF1 and EIF1A, contributing to the maintenance of EIF1 within the open 43S PIC. Upon recognition of the start codon, EIF5 induces eIF2G (EIF2S3) to hydrolyze GTP and initiates a conformational change in the PIC to a closed state. This change enhances the affinity of EIF5-CTD for EIF2-beta (EIF2S2), leading to the release of EIF1 from the PIC. Finally, EIF5 stabilizes the PIC in its closed conformation. EIF5 interacts with various components of the translation machinery, including EIF1A, EIF2-beta (EIF2S2), and EIF5B, as well as with FMR1 isoform 6 in a RNA-dependent manner, highlighting its multifaceted involvement in protein synthesis initiation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
P55010 (M1-I431)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
EIF5 (M1-I431)
Accession # P55010 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EIF5; EIF-5; Eukaryotic Translation Initiation Factor 5; EIF-5A
-
AA Sequence
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI
-
Predicted Molecular Mass
65.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
