ELF3 Protein, Human (His, Strep)
ELF3 Protein, Human (His, Strep) is the recombinant human-derived ELF3, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ELF3 Protein, Human (His, Strep) is the recombinant human-derived ELF3, expressed by E. coli , with Strep, His labeled tag.
Background
ELF3 is a transcriptional activator that binds and transactivates ETS sequences containing the core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Additionally, ELF3 transactivates promoters of collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2, and TGM3, while repressing KRT4 promoter activity. ELF3 is involved in mediating vascular inflammation and may play a critical role in epithelial cell differentiation and tumorigenesis, potentially serving as a downstream effector of the ERBB2 signaling pathway. It may also be associated with mammary gland development and involution. In preimplantation embryos, ELF3 regulates transcription of TATA-less promoters, which is essential for preimplantation development (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P78545-1 (A269-N371)
-
Gene ID1999
-
Protein Length
Partial
-
Synonyms
ELF3; E74-Like ETS Transcription Factor 3 Isoform 10; Prev. ESX; E74-Like ETS Transcription Factor 3 Isoform 12; ESE-1; E74-Like ETS Transcription Factor 3 Isoform 11; ERT; E74-Like ETS Transcription Factor 3 Isoform 17; ETS-Related Transcription Factor E
-
AA Sequence
APRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN
-
Predicted Molecular Mass
15.7 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
