Enterotoxin type G Protein, S. aureus (His-SUMO)
Enterotoxin type G Proteinas, a staphylococcal enterotoxin, is implicated in staphylococcal food poisoning syndrome, causing severe symptoms like high fever, hypotension, diarrhea, shock, and fatalities. Its ability to induce a range of adverse effects underscores its significance in foodborne illnesses, emphasizing the severity of impact on affected individuals. Enterotoxin type G Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived Enterotoxin type G protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Staphylococcus aureus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Enterotoxin type G Proteinas, a staphylococcal enterotoxin, is implicated in staphylococcal food poisoning syndrome, causing severe symptoms like high fever, hypotension, diarrhea, shock, and fatalities. Its ability to induce a range of adverse effects underscores its significance in foodborne illnesses, emphasizing the severity of impact on affected individuals. Enterotoxin type G Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived Enterotoxin type G protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
Enterotoxin type G, a member of staphylococcal enterotoxins, is implicated in the development of staphylococcal food poisoning syndrome. This syndrome is characterized by severe symptoms, including high fever, hypotension, diarrhea, shock, and, in some cases, fatalities. The enterotoxin's ability to induce such a range of adverse effects underscores its significance in the context of foodborne illnesses and highlights the severity of its impact on affected individuals.
Technical Parameters
-
Species Staphylococcus aureus
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
P0A0L7 (Q26-H258)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
SEG (Q26-H258)
Accession # P0A0L7 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Enterotoxin type G; SEG; entG; seg; SA1642
-
AA Sequence
QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
-
Predicted Molecular Mass
43 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
