ENTPD3 Protein, Human (sf9, His)

The ENTPD3 protein exhibits unique enzymatic preferences, with triple hydrolysis specificity for ATP hydrolysis and triple specificity for ADP hydrolysis. This shows a clear affinity for ATP substrate hydrolysis, suggesting a critical role in cellular processes involving the breakdown of ATP molecules. ENTPD3 Protein, Human (sf9, His) is the recombinant human-derived ENTPD3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

The ENTPD3 protein, demonstrates a notable threefold preference for the hydrolysis of ATP (adenosine triphosphate) over ADP (adenosine diphosphate). This enzymatic specificity implies a particular affinity for cleaving the high-energy phosphate bonds in ATP, highlighting its role in the hydrolysis of this essential nucleotide triphosphate. The preference for ATP hydrolysis suggests that ENTPD3 may play a significant role in regulating cellular energy dynamics, potentially participating in cellular processes that require ATP as an energy source. Further investigations may provide insights into the specific cellular pathways and functions associated with ENTPD3's enzymatic activity and its impact on cellular bioenergetics.

Measured by its ability to hydrolyze the 5’-phosphate group from the substrate adenosine-5’-triphosphate (ATP) and the specific activity is >70,000 pmol/min/µg.

Human

Sf9 insect cells

C-His

O75355 (Q44-P485)

956  [NCBI]

Extracellular Domain

QIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIEPP

Approximately 50 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.