Copy Link Print Information

ENTPD3 Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

The ENTPD3 protein exhibits unique enzymatic preferences, with triple hydrolysis specificity for ATP hydrolysis and triple specificity for ADP hydrolysis. This shows a clear affinity for ATP substrate hydrolysis, suggesting a critical role in cellular processes involving the breakdown of ATP molecules. ENTPD3 Protein, Human (sf9, His) is the recombinant human-derived ENTPD3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • ENTPD3 Protein, Human (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The ENTPD3 protein exhibits unique enzymatic preferences, with triple hydrolysis specificity for ATP hydrolysis and triple specificity for ADP hydrolysis. This shows a clear affinity for ATP substrate hydrolysis, suggesting a critical role in cellular processes involving the breakdown of ATP molecules. ENTPD3 Protein, Human (sf9, His) is the recombinant human-derived ENTPD3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The ENTPD3 protein, demonstrates a notable threefold preference for the hydrolysis of ATP (adenosine triphosphate) over ADP (adenosine diphosphate). This enzymatic specificity implies a particular affinity for cleaving the high-energy phosphate bonds in ATP, highlighting its role in the hydrolysis of this essential nucleotide triphosphate. The preference for ATP hydrolysis suggests that ENTPD3 may play a significant role in regulating cellular energy dynamics, potentially participating in cellular processes that require ATP as an energy source. Further investigations may provide insights into the specific cellular pathways and functions associated with ENTPD3's enzymatic activity and its impact on cellular bioenergetics.

Verified Bioactivity

Measured by its ability to hydrolyze the 5’-phosphate group from the substrate adenosine-5’-triphosphate (ATP) and the specific activity is >70,000 pmol/min/µg.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession

    O75355 (Q44-P485)

  • Gene ID
    956  [NCBI]
  • Molecular Construction
    • N-term
    • ENTPD3 (Q44-P485)
      Accession # O75355
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ENTPD3; CD39 Antigen-Like 3; Prev. CD39L3; Ecto-Apyrase 3; HB6; Ecto-ATPase 3; NTPDase-3; ENTPDase-3; Ecto-ATP Diphosphohydrolase 3; NTPDase 3; Ectonucleoside Triphosphate Diphosphohydrolase 3; Ecto-ATPDase 3

  • AA Sequence

    QIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIEPP

  • Predicted Molecular Mass

    51 kDa

  • Molecular Weight

    Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ENTPD3 Protein, Human (sf9, His) Product Image
    1/16
  • ENTPD3 Protein, Human (sf9, His) Product Image