1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. ENTPD5 Protein, Human (sf9, His)

The ENTPD5 protein is located in the lumen of the endoplasmic reticulum and plays a crucial role in glycoprotein processing by preferentially hydrolyzing nucleoside diphosphates, including GDP, IDP, and UDP. Its enzymatic activity ensures the clearance of UDP, an end-product feedback inhibitor of UDP-Glc:glycoprotein glucosyltransferase. ENTPD5 Protein, Human (sf9, His) is the recombinant human-derived ENTPD5 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ENTPD5 protein is located in the lumen of the endoplasmic reticulum and plays a crucial role in glycoprotein processing by preferentially hydrolyzing nucleoside diphosphates, including GDP, IDP, and UDP. Its enzymatic activity ensures the clearance of UDP, an end-product feedback inhibitor of UDP-Glc:glycoprotein glucosyltransferase. ENTPD5 Protein, Human (sf9, His) is the recombinant human-derived ENTPD5 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

ENTPD5 protein exhibits its enzymatic activity by preferentially hydrolyzing nucleoside diphosphates, showing a distinct preference for GDP, IDP, and UDP over ADP and CDP. Operating within the endoplasmic reticulum lumen, ENTPD5 plays a crucial role in the clearance of UDP, which functions as an end-product feedback inhibitor for UDP-Glc:glycoprotein glucosyltransferases. The hydrolyzed UMP is transported back to the cytosol through an UDP-sugar antiporter, where it is consumed to regenerate UDP-glucose. This mechanism positively regulates protein reglucosylation by ensuring the removal of UDP from the ER lumen and facilitating the regeneration of UDP-glucose. The process of protein reglucosylation, governed by ENTPD5, is integral to maintaining proper glycoprotein folding and upholding quality control within the endoplasmic reticulum.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

O75356 (V21-H428)

Gene ID

957  [NCBI]

Molecular Construction
N-term
ENTPD5 (V21-H428)
Accession # O75356
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ectonucleoside triphosphate diphosphohydrolase 5; NTPDase 5; CD39L4; PCPH
AA Sequence

VSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH

Predicted Molecular Mass
47 kDa
Molecular Weight

Approximately 45 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ENTPD5 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ENTPD5 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ENTPD5 Protein, Human (sf9, His)
Cat. No.:
HY-P76905
Quantity:
MCE Japan Authorized Agent: