ENTPD5 Protein, Human (sf9, His)
The ENTPD5 protein is located in the lumen of the endoplasmic reticulum and plays a crucial role in glycoprotein processing by preferentially hydrolyzing nucleoside diphosphates, including GDP, IDP, and UDP. Its enzymatic activity ensures the clearance of UDP, an end-product feedback inhibitor of UDP-Glc:glycoprotein glucosyltransferase. ENTPD5 Protein, Human (sf9, His) is the recombinant human-derived ENTPD5 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ENTPD5 protein is located in the lumen of the endoplasmic reticulum and plays a crucial role in glycoprotein processing by preferentially hydrolyzing nucleoside diphosphates, including GDP, IDP, and UDP. Its enzymatic activity ensures the clearance of UDP, an end-product feedback inhibitor of UDP-Glc:glycoprotein glucosyltransferase. ENTPD5 Protein, Human (sf9, His) is the recombinant human-derived ENTPD5 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
ENTPD5 protein exhibits its enzymatic activity by preferentially hydrolyzing nucleoside diphosphates, showing a distinct preference for GDP, IDP, and UDP over ADP and CDP. Operating within the endoplasmic reticulum lumen, ENTPD5 plays a crucial role in the clearance of UDP, which functions as an end-product feedback inhibitor for UDP-Glc:glycoprotein glucosyltransferases. The hydrolyzed UMP is transported back to the cytosol through an UDP-sugar antiporter, where it is consumed to regenerate UDP-glucose. This mechanism positively regulates protein reglucosylation by ensuring the removal of UDP from the ER lumen and facilitating the regeneration of UDP-glucose. The process of protein reglucosylation, governed by ENTPD5, is integral to maintaining proper glycoprotein folding and upholding quality control within the endoplasmic reticulum.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
O75356 (V21-H428)
-
Molecular Construction
-
N-term
-
ENTPD5 (V21-H428)
Accession # O75356 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ENTPD5; Nucleoside Diphosphatase; Prev. CD39L4; Proto-Oncogene CPH; Prev. PCPH; GDPase ENTPD5; Guanosine-Diphosphatase ENTPD5; UDPase ENTPD5; Uridine-Diphosphatase ENTPD5; ER-UDPase; NTPDase-5; NTPDase 5; Ectonucleoside Triphosphate Diphosphohydrolase 5;
-
AA Sequence
VSHRNQQTWFEGIFLSSMCPINVSASTLYGIMFDAGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDLGGASTQITFLPQFEKTLEQTPRGYLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALETEGTDGHTFRSACLPRWLEAEWIFGGVKYQYGGNQEGEVGFEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH
-
Predicted Molecular Mass
47 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
