EphB1 Protein, Mouse (Active, sf9, His-GST)
EphB1 protein is a receptor tyrosine kinase that participates in bidirectional signaling with ephrin B ligands (including EFNB1, EFNB2, and EFNB3). It plays a crucial role in retinal axon guidance, neural progenitor cell regulation, dendritic spine maturation, synapse formation, angiogenesis, targeted cell migration, and muscle stem cell maintenance. EphB1 Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived EphB1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
EphB1 protein is a receptor tyrosine kinase that participates in bidirectional signaling with ephrin B ligands (including EFNB1, EFNB2, and EFNB3). It plays a crucial role in retinal axon guidance, neural progenitor cell regulation, dendritic spine maturation, synapse formation, angiogenesis, targeted cell migration, and muscle stem cell maintenance. EphB1 Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived EphB1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
EphB1 protein is a receptor tyrosine kinase that binds to ephrin-B ligands on neighboring cells, resulting in contact-dependent bidirectional signaling. This receptor mediates both forward signaling and reverse signaling pathways. Its ligands include EFNB1, EFNB2, and EFNB3, which play important roles in various cellular processes. During nervous system development, EphB1 regulates retinal axon guidance and interacts with EFNB2. In the adult nervous system, it works together with EFNB3 to regulate chemotaxis, proliferation, and polarity of neural progenitors. EphB1 is also involved in dendritic spine maturation, synapse formation, angiogenesis, targeted cell migration, and adhesion. Activation by EFNB1 and other ephrin-B ligands activates MAPK/ERK and JNK signaling pathways, which regulate cell migration and adhesion. Additionally, EphB1 is important for maintaining the pool of muscle stem cells (satellite cells) by promoting self-renewal and reducing activation and differentiation.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
Q8CBF3-1 (M591-A984)
-
Molecular Construction
-
N-term
-
His-GST
-
EphB1 (M591-A984)
Accession # Q8CBF3-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
EPHB1; ELK; Prev. EPHT2; EK6; Hek6; Receptor Protein-Tyrosine Kinase; Neuronally-Expressed EPH-Related Tyrosine Kinase; Eph Tyrosine Kinase 2; Tyrosine-Protein Kinase Receptor EPH-2; EPH Tyrosine Kinase 2; Ephrin Type-B Receptor 1; EphB1; EPH-Like Kinase
-
AA Sequence
MKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGVTLAGHQKKILSSIHSMRVQMNQSPSVMA
-
Predicted Molecular Mass
72.4 kDa
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)