EPT1 Protein, Human (GST)
Based on 1 Customer Validation
The EPT1 protein is an ethanolamine phosphotransferase that crucially transfers phosphoethanolamine in the final step of PE synthesis. This process is critical for PE production and involves multiple membrane-related cellular functions. EPT1 Protein, Human (GST) is the recombinant human-derived EPT1 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The EPT1 protein is an ethanolamine phosphotransferase that crucially transfers phosphoethanolamine in the final step of PE synthesis. This process is critical for PE production and involves multiple membrane-related cellular functions. EPT1 Protein, Human (GST) is the recombinant human-derived EPT1 protein, expressed by E. coli , with N-GST labeled tag.
EPT1 protein serves as an ethanolaminephosphotransferase, facilitating the crucial transfer of phosphoethanolamine (PE) from CDP-ethanolamine to lipid acceptors in the final step of PE synthesis through the 'Kennedy' pathway. This enzymatic process, as elucidated in various studies, is essential for the production of PE, the second most abundant phospholipid in mammalian membranes, and is intricately involved in diverse membrane-related cellular processes. Beyond its primary role in PE synthesis, EPT1 exhibits significance in generating various PE species and may contribute to the synthesis of ether-linked phospholipids, such as plasmanyl- and plasmenyl-PE. This dual functionality suggests its critical involvement in proper myelination and neurodevelopment, emphasizing the multifaceted contributions of EPT1 to cellular lipid metabolism.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9C0D9 (M1-P50)
-
Molecular Construction
-
N-term
-
GST
-
EPT1 (M1-P50)
Accession # Q9C0D9 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SELENOI; SEPI; Prev. EPT1; HEPT1; SELI; SPG81; Ethanolaminephosphotransferase 1; SelI; KIAA1724; Selenoprotein I; Ethanolaminephosphotransferase 1 (CDP-Ethanolamine-Specific)
-
AA Sequence
MAGYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTIVKVFPTWLAP
-
Predicted Molecular Mass
32.6 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (234 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
