ESM-1 Protein, Human (sf9, His)
ESM-1 Protein, an endothelial cell-specific molecule, is involved in angiogenesis and vascular permeability. It promotes the growth of new blood vessels and regulates the integrity of blood vessel walls. ESM-1 Protein, Human (sf9, His) is the recombinant human-derived ESM-1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ESM-1 Protein, an endothelial cell-specific molecule, is involved in angiogenesis and vascular permeability. It promotes the growth of new blood vessels and regulates the integrity of blood vessel walls. ESM-1 Protein, Human (sf9, His) is the recombinant human-derived ESM-1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
ESM-1 plays a significant role in angiogenesis, actively promoting the sprouting of new blood vessels. Additionally, it is implicated in lung endothelial cell-leukocyte interactions, suggesting its potential importance in inflammatory processes within the pulmonary vasculature. ESM-1 functions as a monomer in its molecular structure.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q9NQ30-1/NP_008967.1 (W20-R184)
-
Molecular Construction
-
N-term
-
ESM-1 (W20-R184)
Accession # Q9NQ30-1/NP_008967.1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ESM1; ESM-1; Endothelial Cell Specific Molecule 1; Endocan; Endothelial Cell-Specific Molecule 1
-
AA Sequence
WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
-
Predicted Molecular Mass
19.6 kDa
-
Molecular Weight
Approximately 23-27 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
