EXTL2 Protein, Mouse (HEK293, His)
The EXTL2 protein is a key glycosyltransferase in heparan sulfate biosynthesis, responsible for overseeing the conversion of β-1-4-linked glucuronic acid (GlcA) and α-1-4-linked N-acetylglucosamine (GlcNAc) units Alternating sulfate chains are added to the nascent heparan. The function of this enzyme is critical for the complex and precise construction of heparan sulfate, a key component of various biological processes. EXTL2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EXTL2 protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The EXTL2 protein is a key glycosyltransferase in heparan sulfate biosynthesis, responsible for overseeing the conversion of β-1-4-linked glucuronic acid (GlcA) and α-1-4-linked N-acetylglucosamine (GlcNAc) units Alternating sulfate chains are added to the nascent heparan. The function of this enzyme is critical for the complex and precise construction of heparan sulfate, a key component of various biological processes. EXTL2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EXTL2 protein, expressed by HEK293 , with N-6*His labeled tag.
Background
EXTL2 (Exostosin-Like 2) is a glycosyltransferase crucial for the biosynthesis of heparan sulfate, a complex and essential glycosaminoglycan. Its enzymatic activity involves the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains. This enzymatic process is integral to the construction of the intricate polysaccharide structure of heparan sulfate, which, in turn, plays key roles in various cellular functions, including cell signaling, adhesion, and tissue development.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-6*His
-
Accession
Q9ES89 (N43-M330)
-
Molecular Construction
-
N-term
-
6*His
-
EXTL2 (N43-M330)
Accession # Q9ES89 -
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
EXTL2; Exostosin-Like 2; Exostosin Like Glycosyltransferase 2; Exostoses (Multiple)-Like 2; Glucuronyl-Galactosyl-Proteoglycan 4-Alpha-N-Acetylglucosaminyltransferase; EXTR2; Alpha-1,4-N-Acetylhexosaminyltransferase EXTL2; Alpha-1,4-N-Acteylhexosaminyltra
-
AA Sequence
NIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM
-
Predicted Molecular Mass
33.6 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
