1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. fbaA Protein, Shigella flexneri (His)

The fbaA protein plays a critical role in cellular metabolism by catalyzing the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerol phosphate) with glyceraldehyde 3-phosphate (G3P), leading to the formation of fructose 1,6-bisphosphate (FBP) role. This enzyme activity is essential for gluconeogenesis and glycolysis, reflecting its involvement in the conversion of key intermediates necessary for energy production and carbon flux. fbaA Protein, Shigella flexneri (His) is the recombinant fbaA protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The fbaA protein plays a critical role in cellular metabolism by catalyzing the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerol phosphate) with glyceraldehyde 3-phosphate (G3P), leading to the formation of fructose 1,6-bisphosphate (FBP) role. This enzyme activity is essential for gluconeogenesis and glycolysis, reflecting its involvement in the conversion of key intermediates necessary for energy production and carbon flux. fbaA Protein, Shigella flexneri (His) is the recombinant fbaA protein, expressed by E. coli , with N-6*His labeled tag.

Background

The fbaA protein is an enzyme that catalyzes the crucial aldol condensation reaction in both gluconeogenesis and glycolysis. Specifically, it facilitates the condensation of dihydroxyacetone phosphate (DHAP or glycerone-phosphate) with glyceraldehyde 3-phosphate (G3P), leading to the formation of fructose 1,6-bisphosphate (FBP). This reversible reaction is central to the interconversion of metabolites between glycolysis and gluconeogenesis, playing a pivotal role in cellular energy metabolism. The fbaA enzyme's ability to regulate the conversion of key phosphorylated intermediates highlights its significance in maintaining the balance of glucose production and utilization within the cell. It has to emphasize fbaA's role in this essential biochemical pathway, underlining its importance in cellular energy homeostasis.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

P0AB73 (M1-L359)

Gene ID

1025905

Molecular Construction
N-term
6*His
fbaA (M1-L359)
Accession # P0AB73
C-term
Protein Length

Full Length

Synonyms
fbaA; Fructose-bisphosphate aldolase class 2; FBP aldolase; FBPA; Fructose-1; 6-bisphosphate aldolase; Fructose-bisphosphate aldolase class II
AA Sequence

MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

fbaA Protein, Shigella flexneri (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

fbaA Protein, Shigella flexneri (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
fbaA Protein, Shigella flexneri (His)
Cat. No.:
HY-P701884
Quantity:
MCE Japan Authorized Agent: