fbaA Protein, Shigella flexneri
The fbaA protein plays a critical role in cellular metabolism by catalyzing the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerol phosphate) with glyceraldehyde 3-phosphate (G3P), leading to the formation of fructose 1,6-bisphosphate (FBP) role. This enzyme activity is essential for gluconeogenesis and glycolysis, reflecting its involvement in the conversion of key intermediates necessary for energy production and carbon flux. fbaA Protein, Shigella flexneri is the recombinant fbaA protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The fbaA protein plays a critical role in cellular metabolism by catalyzing the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerol phosphate) with glyceraldehyde 3-phosphate (G3P), leading to the formation of fructose 1,6-bisphosphate (FBP) role. This enzyme activity is essential for gluconeogenesis and glycolysis, reflecting its involvement in the conversion of key intermediates necessary for energy production and carbon flux. fbaA Protein, Shigella flexneri is the recombinant fbaA protein, expressed by E. coli , with tag free.
Background
The fbaA protein is an enzyme that catalyzes the crucial aldol condensation reaction in both gluconeogenesis and glycolysis. Specifically, it facilitates the condensation of dihydroxyacetone phosphate (DHAP or glycerone-phosphate) with glyceraldehyde 3-phosphate (G3P), leading to the formation of fructose 1,6-bisphosphate (FBP). This reversible reaction is central to the interconversion of metabolites between glycolysis and gluconeogenesis, playing a pivotal role in cellular energy metabolism. The fbaA enzyme's ability to regulate the conversion of key phosphorylated intermediates highlights its significance in maintaining the balance of glucose production and utilization within the cell. It has to emphasize fbaA's role in this essential biochemical pathway, underlining its importance in cellular energy homeostasis.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
P0AB73 (M1-L359)
-
Gene ID1025905
-
Molecular Construction
-
N-term
-
fbaA (M1-L359)
Accession # P0AB73 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S3110; SF2910; fbaA; Fructose-bisphosphate aldolase class II; Fructose-1,6-bisphosphate aldolase; FBPA; FBP aldolase; EC:4.1.2.13; Fructose-bisphosphate aldolase class 2
-
AA Sequence
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)