Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2)
Based on 1 Customer Validation
Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA2) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by E. coli , with tag free.
Background
The Fc gamma RIIIB/CD16b Protein acts as a receptor for the Fc region of immunoglobulins gamma, exhibiting low affinity and binding to both complexed or aggregated IgG as well as monomeric IgG. In contrast to Fc gamma RIIIA, Fc gamma RIIIB lacks the ability to mediate antibody-dependent cytotoxicity and phagocytosis. Instead, it may function as a trap for immune complexes circulating in the periphery, without activating neutrophils. The protein exists as a monomer and interacts with INPP5D/SHIP1, suggesting its involvement in intracellular signaling pathways associated with immune responses.
Verified Bioactivity
1.Measured by its ability to bind human IgG1 in a functional ELISA.
2.Labeling ratio of biotin to protein: 5.51.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O75015 (M18-G193)
-
Molecular Construction
-
N-term
-
CD16b (M18-G193)
Accession # O75015 -
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Conjugate Method
The biotin is covalently conjugated to the primary amine groups of the protein using chemical labeling methods.
-
Synonyms
FCGR3B; IgG Fc Receptor III-1; Prev. FCGR3; Fc-Gamma RIIIb; Prev. FCG3; CD16-I; FcRIIIb; HNA-1; FcgammaRIIIb; Fc Fragment Of IgG, Low Affinity IIIb, Receptor For (CD16); CD16b; CD16b Antigen; CD16; Fc-Gamma RIII; Low Affinity Immunoglobulin Gamma Fc Regio
-
AA Sequence
MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQG
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
