1. Recombinant Proteins
  2. Fc Receptors Biotinylated Proteins
  3. Fc-gamma Receptor
  4. Fc gamma RIV/CD16-2
  5. FcgR4/CD16-2 Protein, Mouse (Biotinylated, HEK293, His-Avi)

FcgR4/CD16-2 Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P76917
Handling Instructions Technical Support

The FcγR4/CD16-2 protein is an IgG receptor with moderate affinity for IgG2a and IgG2b. It recognizes virus-specific IgG, triggers antibody-dependent cellular cytotoxicity, and provides protection against fatal influenza infection. FcgR4/CD16-2 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived FcgR4/CD16-2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FcγR4/CD16-2 protein is an IgG receptor with moderate affinity for IgG2a and IgG2b. It recognizes virus-specific IgG, triggers antibody-dependent cellular cytotoxicity, and provides protection against fatal influenza infection. FcgR4/CD16-2 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived FcgR4/CD16-2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The FcγR4/CD16-2 Protein serves as a receptor for the constant Fc fragment of immunoglobulin gamma (IgG), exhibiting intermediate affinity for both IgG2a and IgG2b. It recognizes neutralizing virus-specific IgGs on infected cells, triggering antibody-dependent cellular cytotoxicity (ADCC) and conferring protection against lethal influenza virus infection. On splenic dendritic cells, FcγR4 efficiently uptakes antigen immune complexes, directing them into MHC class I and II antigen presentation pathways, thereby enhancing CD4-positive and CD8-positive T cell immune responses. Additionally, FcγR4 plays a crucial role in mediating neutrophil activation by IgG complexes, acting redundantly with FCGR2A. It contributes to bone resorption by enhancing osteoclast differentiation upon binding to IgG2a. Furthermore, FcγR4 functions as a receptor for the Fc region of immunoglobulin epsilon (IgE), binding to both a and b allotypes of IgE and promoting macrophage-mediated phagocytosis, antigen presentation to T cells, and the late phase of cutaneous allergic reactions. It forms a heterooligomeric complex with ITAM-containing signaling subunits FCER1G and interacts with the Fc region of antigen-complexed IgG.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-His

Accession

A0A0B4J1G0 (Q19-Q203)

Gene ID
Molecular Construction
N-term
FcgR4 (Q19-Q203)
Accession # A0A0B4J1G0
Avi-His
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
Low affinity immunoglobulin gamma Fc region receptor IV; CD16-2; FcgammaRIV; Fcrl3
AA Sequence

QAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ

Predicted Molecular Mass
24.2 kDa
Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FcgR4/CD16-2 Protein, Mouse (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FcgR4/CD16-2 Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FcgR4/CD16-2 Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P76917
Quantity:
MCE Japan Authorized Agent: